KEGG   Chryseobacterium taklimakanense: 4412677_00287Help
Entry
4412677_00287     CDS       T05512                                 

Gene name
tagD
Definition
(GenBank) Glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4412677_00287 (tagD)
Enzymes [BR:ctak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     4412677_00287 (tagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: SNV34240
UniProt: A0A239WJE3
Position
1:complement(294617..295117)
Genome map
AA seq 166 aa AA seqDB search
MKSRKIKTGITFSCFDLLHAGHIRMLAEAKSQCDYLIVGLQTDPTIDRPEKNKPVQTVVE
RYTQLKGCQYVDEIIPYTTERDLEDILKLYQIDIRILGDEYKDKNFTGRSFCEENGITLY
YNKRHHRFSSTLLRSEVYKKEKAKNLPADVQPEITSSQFSKNGKIT
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgaaaaataaaaaccggcatcactttcagttgctttgatctgctgcacgcc
gggcatataagaatgctggctgaagccaaatcccagtgcgactatctcattgtaggcctt
caaaccgaccctactattgaccggccggaaaaaaacaaaccggtgcagaccgttgtagag
cggtacacacagctgaagggctgccaatatgtagatgaaattattccctacaccacggaa
agagatctggaagatattctgaaactgtatcagatagacatccggattctgggggatgaa
tacaaagacaagaattttactggaagaagtttctgtgaagaaaatggaatcacgctttat
tataacaaaaggcaccatcggttttccagcacgctgctccgttcggaagtgtataaaaag
gaaaaggcaaaaaatctccctgctgatgtgcagccggaaataacctcttcacaatttagc
aaaaacggcaaaataacttaa

DBGET integrated database retrieval system