KEGG   Chryseobacterium taklimakanense: 4412677_00689Help
Entry
4412677_00689     CDS       T05512                                 

Gene name
hemN_1
Definition
(GenBank) Oxygen-independent coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00860  Porphyrin and chlorophyll metabolism
ctak01100  Metabolic pathways
ctak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4412677_00689 (hemN_1)
Enzymes [BR:ctak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     4412677_00689 (hemN_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C HTH_45 UCR_14kD
Motif
Other DBs
NCBI-ProteinID: SNV37629
UniProt: A0A239WTQ3
Position
1:complement(687811..689316)
Genome map
AA seq 501 aa AA seqDB search
MVWRLPLELEHASDPATAHNPPFLQVRKQSGTPKTYSYFCGMNNSLIDKYNIPGPRYTSY
PTVPYWDNAGFTLEKWENSVIRAFNESNDAEGISIYIHLPFCEALCTFCACHKRITKQHS
VETPYLESVLKEWDLYVELFKKGNETESTKPKIKELHLGGGTPTFFSPENLRILLEGIFA
KSDIAENPEFSFEGHPNNTTKEHLQTLYDLGFRRCSFGVQDYDLKVQKAINRIQPFENVE
NVTRWAREIGYTSISHDLVFGLPHQDWQKMESTIRKTMELKPDRLAFYSYAHVPWIKGVG
QRGFDENDLPSGEEKRKLYENGKQLLEELGYREVGMDHFAMEHDDLYQSMLNGKIHRNFM
GYSSSKTLLMVGLGMSAISDSWYAFAQNEKTVEDYQKRVAEGIIPVFRGHMLDAEDLIIR
KHILNLMCRLETSWDTQNFIPEIENSIEKLKEMEEDGLVEISENQIRITEKGRAFTRNVA
MTFDLRMLRNKPETRIFSMTV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggaggttgccgctggagctggagcatgcctcggacccggccacggcacacaat
ccaccgtttttacaagtccgaaaacagagcggcactcccaaaacttattcgtatttttgc
ggtatgaataattcactcatcgataaatataatattccggggccgcgttacacttcttat
cctacagttccgtactgggataacgccggttttactttggaaaaatgggaaaattccgtg
atcagggcttttaatgaaagcaatgatgccgaaggaatatccatctatattcacttgccg
ttttgcgaggcgctctgcacattttgtgcctgccataagcggattacaaagcaacattct
gtagagacaccctatttggaaagcgttttgaaagaatgggatttgtatgtggaattattt
aaaaaaggaaatgaaacggagagcacaaagccgaagattaaggaacttcatctgggtggc
ggtacgccgacatttttctcaccggagaaccttagaattttgcttgaaggaatatttgca
aaatcagatattgccgaaaatccggaattcagttttgaagggcatccgaacaatacgaca
aaggagcatttgcaaacgctttacgatctgggattcaggagatgcagcttcggcgtgcag
gattatgaccttaaggtgcagaaagccatcaacaggattcagccgtttgaaaacgtagaa
aatgtcaccagatgggcccgcgaaatcggctataccagcatttcccacgatttggttttc
gggctgccgcatcaggactggcaaaaaatggaatccacgattcgcaaaacgatggaactg
aaacccgacaggctggcattctattcttatgctcatgtgccgtggattaaaggagttggg
cagagaggttttgatgaaaacgacctgcccagcggtgaagaaaaacgtaaactttacgaa
aacggtaagcagcttctcgaagaactgggctacagggaagtcggcatggatcactttgcg
atggaacatgatgacctttatcagtcgatgctaaacggtaagattcaccgtaattttatg
ggttattcttccagcaaaaccctgttgatggtcggtctgggaatgtctgcgatttctgat
tcgtggtatgcctttgcccaaaatgaaaaaacagtggaagactatcaaaaaagagttgca
gaaggcatcattcctgtattccgcggtcatatgctggatgcggaagatctgatcatccgc
aaacacatcctcaatttgatgtgccgtctggaaacttcttgggatacccagaatttcatt
cctgaaatcgaaaactccatcgaaaaacttaaggaaatggaagaggacggtttggtggaa
atctctgaaaaccaaattagaattaccgaaaaaggccgtgcattcaccagaaatgtagca
atgactttcgatttaagaatgctcagaaataagccggaaaccagaattttctcaatgacg
gtgtaa

DBGET integrated database retrieval system