KEGG   Chryseobacterium taklimakanense: 4412677_01094Help
Entry
4412677_01094     CDS       T05512                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00310  Lysine degradation
ctak01100  Metabolic pathways
ctak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4412677_01094 (lhgO)
Enzymes [BR:ctak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     4412677_01094 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_3 NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_2 Mqo GMC_oxred_N Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: SNV42480
UniProt: A0A239X7S2
Position
1:complement(1135141..1136349)
Genome map
AA seq 402 aa AA seqDB search
MMYDFVVIGAGLVGLSTAYHLKLNNPASKVLVLEKEGGVSQHQSGHNSGVIHSGIYYKPG
SLKAKNCISGYRSVIEFAEKYGIKYDLCGKIIVATSDEELPLLDNIYNRGVANGLQNLKY
LSREEFREIEPHCEGVKAIKVPQTGIIDYPAVAEKIKELFTELGGEVGFNHQVINIKNGT
EITVETDKGDFQTKKVISCAGLYSDKVANMTTANKDFIIVPFRGEYYKIKDKKKHLVKHL
IYPVPDPNFPFLGVHFTRMVDGNIEAGPNAVLAFKREGYKFSDFNFAETLDTFGYPGFWK
IAAKYGKTGLGEIYRSLSKAAFTKALQKLMPEIQEDDLVPGGSGVRAQALRKDGSLIDDF
DIIKSGNVIHVRNAPSPAATSCLSIGETISNLALEINKIRKF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgatttcgtcgttatcggtgcgggtttagtggggctttctaccgcataccat
cttaaactgaacaatcctgcttccaaggtcttggttttggaaaaagaaggtggtgtttcc
caacatcagtcgggacacaacagcggcgtcatacacagcggaatttactacaaaccggga
agtctgaaagccaaaaactgtatttcagggtatcggtctgtcatcgaatttgccgaaaaa
tacggcattaagtacgatctctgcggcaaaattattgtcgcaacctcggacgaagaactg
cccttactcgacaatatctacaatcggggcgtcgccaatggacttcaaaatttaaagtac
ctgtcacgggaagaatttagagagatagaaccgcactgcgaaggtgttaaggcgattaaa
gttccgcaaacgggcatcattgattatccggcagttgcagaaaaaatcaaggagctgttt
acagaactcggcggcgaagtaggttttaatcatcaggtgataaatattaaaaatgggacc
gaaattacggtggaaaccgacaaaggcgatttccagacgaaaaaagtgatttcctgcgcc
ggactttattccgataaagttgccaatatgacgaccgccaacaaagatttcatcatcgtt
ccttttcgcggcgaatattataaaattaaagacaaaaaaaaacacctcgtcaaacatttg
atctatcctgttccggatccgaattttccttttctgggcgtgcattttacacggatggtt
gacggaaatatcgaagccggcccgaatgcggttctggcttttaaaagagagggttacaaa
ttctcggattttaattttgctgaaactttggacacgttcggttatcccggtttttggaaa
attgcagcgaagtacggtaaaacaggtttgggtgaaatataccgttccttatcgaaagcc
gcatttaccaaagccttacaaaaattaatgccggaaattcaggaagacgatttggttccg
ggcggctccggcgttagagcacaggcgctgaggaaagacggcagcctgatcgatgatttc
gatatcatcaagagtggcaatgtgatacacgtgagaaatgcaccctcaccggcggcgaca
tcatgtctgtcaattggggaaaccatcagtaaccttgcattagaaattaataaaatacga
aagttctaa

DBGET integrated database retrieval system