KEGG   Chryseobacterium taklimakanense: 4412677_01449Help
Entry
4412677_01449     CDS       T05512                                 

Gene name
phoD
Definition
(GenBank) Alkaline phosphatase D precursor
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00790  Folate biosynthesis
ctak01100  Metabolic pathways
ctak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4412677_01449 (phoD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    4412677_01449 (phoD)
Enzymes [BR:ctak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     4412677_01449 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: SNV44887
UniProt: A0A239XDW0
Position
1:1501763..1503088
Genome map
AA seq 441 aa AA seqDB search
MKLLKILFLLAFTSTFSQQNLLQSGPMLGYVEMTEAKIWVQTKAPAKVKVEYSSPENPSE
TFISNEVSTVKDNAYTAHLILEKIRPGKKYNYKVLINNQPLKFNYETSFTAKKLWQWRED
APEFTVALGSCAYMNEPEVDRPGTPYGGNFEIFTSIGNKKPDIMLWGGDNIYLREADWDS
KTGIYHRYTMTRQQKELQPLMANSQNFAIWDDHDFGPNDADRSYYFKHQTLEAFKDFWAN
KSYGNNPEQNNGNFSTFNWGDAEFFLLDNRFHKSPNDRKTGERTVLGKEQLEWFIDAVTT
SKFPFKIVVIGGQFLNSAAKFENYATYHEERQYILDELEKNNVKGVVFLSGDRHFSELSG
LKRPGKYTLYDWTVSPLTSGVATSALKETNENRVEGSLFMQHNFGLLKFFGNKDNRALKL
ELFDKDGKTLWNKVITLKELQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttttaaaaatcctctttcttttagcgtttacttccaccttttcacagcaaaac
cttctgcaatccggcccgatgcttgggtatgttgaaatgactgaagcaaaaatctgggta
cagactaaagcgccggcgaaagtaaaagtggaatattcctctccggaaaacccttctgaa
acgttcatcagcaatgaagtttcgacggtgaaagacaatgcttacaccgctcatttaatc
cttgagaagatccgtcccggaaaaaaatacaattacaaagttttaatcaacaatcaacca
ttaaaatttaattacgaaacatctttcactgcaaaaaaactgtggcagtggcgcgaagac
gctcctgaattcaccgtggcacttggaagttgtgcttatatgaatgagccggaagtggac
cggccgggaacgccctacggcggtaattttgaaattttcaccagcatcggaaacaagaaa
ccggacatcatgctatggggcggcgacaatatttatcttcgcgaagccgattgggacagc
aaaaccggaatttatcaccgctacacgatgaccaggcagcaaaaggaactgcagccgctt
atggcaaactcacaaaattttgccatttgggacgaccacgattttgggcccaatgacgct
gacaggagttactacttcaaacaccagactctagaggcttttaaagatttctgggcaaat
aaatcttacggcaataatcccgagcagaataacggaaacttctcaacctttaactggggc
gatgcagaatttttccttctggacaaccgctttcacaaatcccctaatgacaggaaaacc
ggtgagcgaaccgttctcggaaaagaacagctggaatggtttattgatgcggtcaccact
tctaaattcccatttaaaattgtagtgattggcggccagttcctcaattcagctgcgaaa
tttgagaattatgccacatatcatgaagaaaggcaatatattttggatgaattggagaaa
aataatgtgaaaggtgtggtctttttaagcggagaccgccacttttctgaactttccgga
ttgaaaaggcctggaaaatatacactttatgactggacggtttccccgctcacttccggt
gtggcaaccagtgcactgaaagaaaccaatgaaaaccgtgtggaaggcagcctatttatg
cagcataacttcgggttactgaaattctttggaaacaaagacaacagggcgctgaaactt
gaattgtttgataaagacgggaaaacgctttggaataaagtaattacactgaaggaactg
cagtaa

DBGET integrated database retrieval system