KEGG   Chryseobacterium taklimakanense: 4412677_02320Help
Entry
4412677_02320     CDS       T05512                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00900  Terpenoid backbone biosynthesis
ctak01110  Biosynthesis of secondary metabolites
ctak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4412677_02320 (mvaA)
Enzymes [BR:ctak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     4412677_02320 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: SNV50291
UniProt: A0A239XTN7
Position
1:2385727..2387055
Genome map
AA seq 442 aa AA seqDB search
MNHQPVEGFSKLTKQGKIDWIVNEYLEGNEEYQQILKQYWNEDPDLQKLHEEFSENTISN
FYMPYGIAPNFLIDGKLLALPMAVEESSVVAAASKSAKFWLDKGGFKTTIINTKKLGHTH
FIFKVESHKLQHFFNFKLKQKLFEATEDITKNMRSRGGGILNIRLVDKTAEMDHYFQLKA
SFDTVDSMGANFINSCLEQFGKTLKEEVANADDFTQEEKDSLQVVMNILSNYTPDCIVRA
EVSCKIDDLKDDSGISNEEFAWKFKQAVTIAEIEPFRATTHNKGIMNGVDAVVIATGNDF
RATEACAHAYAARNGKYSSLTHCTTDNGVFRFWIDLPISVGVVGGLTNLHPLVKFSLALL
GKPSAQELMSILAVSGLAQNFAALRSLVTTGIQKGHMKMHLFNILNQMGATEEEKQYFVN
YFKDKTVSHHEVIAELERIRNK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcaaccggttgaaggtttttctaaacttacaaagcagggaaaaatcgattgg
attgtaaatgaatatcttgaaggaaacgaagaatatcagcagattttgaaacaatactgg
aacgaagatccggacctgcaaaaacttcacgaagaattctccgaaaataccatttccaat
ttttatatgccgtacggaattgctcccaacttcctgattgacgggaaactgttggcttta
ccgatggcggtggaagagagttccgtagtggcagctgcctcaaaatctgccaaattctgg
ttggataaaggcggtttcaaaactacaatcatcaataccaaaaaattgggtcacacgcat
tttattttcaaggttgaatcgcacaaactgcagcattttttcaactttaaattaaagcaa
aaactctttgaagccactgaagacatcaccaaaaatatgcgcagccgcggtggcggaatt
ttaaatatccgcttagtggataaaacagcagaaatggatcattatttccaactgaaagcc
agtttcgatacggtggattctatgggtgcgaatttcattaactcgtgtctggagcagttt
ggtaaaactttgaaggaagaagttgctaatgccgatgatttcactcaggaagaaaaagat
tctcttcaggtggtgatgaatattctttccaattacacgccggactgtatcgtgcgcgct
gaagtttcctgtaaaattgatgatctgaaagatgacagcgggatttccaacgaagaattt
gcctggaaattcaaacaggcggttaccattgccgagattgaaccgttccgtgccaccacg
cataacaaaggcattatgaacggtgtagatgcagtcgtaattgccaccggaaacgatttc
cgtgctaccgaagcctgtgcacacgcttatgctgcgagaaacggaaaatattcttcttta
acgcattgcaccaccgataacggtgttttcaggttttggatcgatttgccgatctctgtg
ggggttgtgggcggtttgacgaacctgcatccgttggtgaaattttctttagctttgctt
ggtaagccttcagcacaggaattgatgagtatcttagcagtttcgggactggcgcagaat
tttgcggcactacgttcactggttaccaccggaattcagaaagggcatatgaaaatgcat
ttgttcaatattctgaaccaaatgggtgcgaccgaagaagagaagcagtattttgtgaat
tatttcaaagataaaaccgtaagccaccacgaggtgattgcggaattggagaggattaga
aataaataa

DBGET integrated database retrieval system