KEGG   Chlamydia trachomatis 434/Bu: CTL0050
Entry
CTL0050           CDS       T00645                                 

Symbol
ompA
Name
(GenBank) major outer membrane protein
  KO
K03162  major outer membrane protein
Organism
ctb  Chlamydia trachomatis 434/Bu
Brite
KEGG Orthology (KO) [BR:ctb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctb02000]
    CTL0050 (ompA)
Transporters [BR:ctb02000]
 Other transporters
  Pores ion channels [TC:1]
   CTL0050 (ompA)
SSDB
Motif
Pfam: Chlam_OMP OMP_b-brl Autotransporter DUF6588 CopB
Other DBs
NCBI-ProteinID: CAP03494
UniProt: P06597
Position
complement(58637..59821)
AA seq 394 aa
MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISM
RMGYYGDFVFDRVLQTDVNKEFQMGAKPTTATGNAAAPSTCTARENPAYGRHMQDAEMFT
NAAYMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENHATVSDSKLVPNMSLD
QSVVELYTDTTFAWSAGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKP
KGYVGQEFPLDLKAGTDGVTGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDA
DTIRIAQPKSATTVFDVTTLNPTIAGAGDVKASAEGQLGDTMQIVSLQLNKMKSRKSCGI
AVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaaaaaactcttgaaatcggtattagtgtttgccgctttgagttctgcttcctccttg
caagctctgcctgtggggaatcctgctgaaccaagccttatgatcgacggaattctatgg
gaaggtttcggcggagatccttgcgatccttgcaccacttggtgtgacgctatcagcatg
cgtatgggttactatggtgactttgttttcgaccgtgttttgcaaacagatgtgaataaa
gaattccaaatgggtgccaagcctacaactgctacaggcaatgctgcagctccatccact
tgtacagcaagagagaatcctgcttacggccgacatatgcaggatgctgagatgtttaca
aatgctgcttacatggcattgaatatttgggatcgttttgatgtattctgtacattagga
gccaccagtggatatcttaaaggaaattcagcatctttcaacttagttgggttattcgga
gataatgagaaccatgctacagtttcagatagtaagcttgtaccaaatatgagcttagat
caatctgttgttgagttgtatacagatactacttttgcttggagtgctggagctcgtgca
gctttgtgggaatgtggatgcgcgactttaggcgcttctttccaatacgctcaatccaag
cctaaagtcgaagaattaaacgttctctgtaacgcagctgagtttactatcaataagcct
aaaggatatgtagggcaagaattccctcttgatcttaaagcaggaacagatggtgtgaca
ggaactaaggatgcctctattgattaccatgaatggcaagcaagtttagctctctcttac
agactgaatatgttcactccctacattggagttaaatggtctcgagcaagttttgatgca
gacacgattcgtattgctcagccgaagtcagctacaactgtctttgatgttaccactctg
aacccaactattgctggagctggcgatgtgaaagctagcgcagagggtcagctcggagat
accatgcaaatcgtttccttgcaattgaacaagatgaaatctagaaaatcttgcggtatt
gcagtaggaacaactattgtggatgcagacaaatacgcagttacagttgagactcgcttg
atcgatgagagagctgctcacgtaaatgcacaattccgcttctaa

DBGET integrated database retrieval system