KEGG   Chlamydia trachomatis L2/434/Bu: CTL0173Help
Entry
CTL0173           CDS       T00645                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Pathway
ctb00900  Terpenoid backbone biosynthesis
ctb01100  Metabolic pathways
ctb01110  Biosynthesis of secondary metabolites
ctb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTL0173 (ispE)
Enzymes [BR:ctb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CTL0173 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 5858491
NCBI-ProteinID: YP_001654264
UniProt: B0B931
Position
219665..220531
Genome map
AA seq 288 aa AA seqDB search
MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLQVINACHLETP
SNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDE
EMRSLAEQIGMDTPFFFSTGAALGVARGEKIIALEESVSDRYVLYFSSEGVLTSRAFAVV
QPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHIGLTGSGATLFVRY
PEILEEDPSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcactttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaa
gatgattttcatgaaatagtcacacgctatcaagcgatagcctttggggatcaactctcc
ttatcaataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcct
agtaattctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcct
gttagttggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagt
aatgcagcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgag
gaaatgcgttccttagccgaacagattggcatggatactccttttttcttttctacagga
gcagccttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagat
agatatgttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgtcgta
caaccttcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaag
cctgtttttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgg
gcggaacttcctgtgcatatagggctaacgggatcaggggcaaccttatttgtccgttac
ccagaaatcttagaggaagacccttcttatgcagctcagatacaaagagcagtaacgtta
agcggaggattattgacttctccgatacgaagagatcctacagcttggtatagcatctat
tctgaaagtgcacttgcagctacataa

DBGET integrated database retrieval system