KEGG   Chlamydia trachomatis 434/Bu: CTL0778
Entry
CTL0778           CDS       T00645                                 

Gene name
rplE
Definition
(RefSeq) 50S ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
ctb  Chlamydia trachomatis 434/Bu
Pathway
ctb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTL0778 (rplE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctb03011]
    CTL0778 (rplE)
Ribosome [BR:ctb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CTL0778 (rplE)
  Bacteria
    CTL0778 (rplE)
  Archaea
    CTL0778 (rplE)
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5
Other DBs
NCBI-GeneID: 5858563
NCBI-ProteinID: YP_001654849
UniProt: B0B890
Position
complement(908869..909411)
AA seq 180 aa
MSRLKKLYTEEIRKTLQDKFQYENVMQIPVLKKIVISMGLAEAAKDKNLFQAHLEELAVI
SGQKPLVTRAKNSIAGFKLREGQGIGAKVTLRGIRMYDFMDRFCNIVSPRIRDFRGFSCK
GDGRGCYSLGLDDQQIFPEVDLDRVKRSQGMNITWVTTAQTDAECLTLLECMGLRFKKAQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atgagcaggttaaaaaaactatatactgaagagataagaaagactcttcaagataagttt
cagtatgaaaatgtaatgcaaatccctgttcttaagaagatcgtaataagcatggggctt
gcagaggctgcaaaggataaaaaccttttccaggctcatttagaggaattggcggttatc
tctggtcaaaaacctttggtaacaagagctaaaaactctatcgcaggcttcaagttacga
gagggtcagggcatcggagcaaaagtcactctacgtggaatccgtatgtatgactttatg
gaccgtttttgcaatattgtctccccaagaattcgagactttagaggattctcttgtaaa
ggagatggacgaggatgttattcccttggtttagatgatcagcaaatctttcctgaagtt
gatttagatcgtgttaaacgatctcagggaatgaatattacttgggtaactacagcacaa
accgatgcggagtgccttaccttgttagagtgtatgggcttgcgtttcaagaaggctcaa
taa

DBGET integrated database retrieval system