KEGG   Chlamydia trachomatis 434/Bu: CTL0843
Entry
CTL0843           CDS       T00645                                 
Name
(GenBank) putative integral membrane protein
Organism
ctb  Chlamydia trachomatis 434/Bu
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-ProteinID: CAP04280
UniProt: B0B8F4
Position
complement(971272..972255)
AA seq 327 aa
MVAVKALLFACTLRTCVFKPCCDMAIFLIFLNAFIWSSSFALSKSAMEAAAPLFVTGSRM
VLAGVVLFGLLLCKRESLRLPRPAIMPIVLLSVIGFYLTNVLEFIGLQRLSSSTACFIYG
FSPFTAAFCSYVQLREVVTWKKLGGLSLGLVSYLVYLLFGGSEDVAEWGWQLGLPELLLI
AATCLSSYGWTLLRKLGRRCESLSMTAINAYAMVIAGVLSLIHSAVTEVWNPVPVENPLL
FLQAIGALVIFSNLICYNLFAKLLRSFSSTFLSFCNLVMPLFASFFGWLLLGESFPPGLL
FAVGFMVLGCRLIYHEEFRQGYVLTSE
NT seq 984 nt   +upstreamnt  +downstreamnt
atggtggcggtcaaggcgttgttattcgcttgtactctacgaacctgtgtgtttaaaccc
tgttgtgacatggctattttcttaattttcctgaatgctttcatctggtcctcttcgttt
gctttaagcaagtcggcaatggaagctgcagctcctttatttgtgacagggagtcgaatg
gtattggccggagtagttctttttgggctgctattatgtaaacgcgagtctcttcgtctg
ccgcgtccagctatcatgcctatagtattgctctccgttatcggtttctatttaactaat
gtattggaatttattggattgcagaggctttcatcctcaacagcttgctttatttatgga
ttttcacctttcacagccgctttttgttcttacgtccagcttagagaggttgttacttgg
aaaaagcttgggggattaagtttagggttagtcagttaccttgtgtacctgctgtttgga
ggtagcgaagatgtagctgagtggggatggcagttaggattaccggaactcttattgata
gcagctacctgtctttcttcttatggttggactttgctcagaaaattagggcgaagatgt
gagtcgctatccatgaccgcgattaatgcgtatgctatggtcatcgcaggggtgttgtcg
ttaatacattctgctgtcaccgaagtttggaaccctgtgcctgtggaaaaccctttacta
tttctacaggcgataggtgctttggtgattttttcgaatttgatttgctataacttgttt
gctaagttattgcgttctttttcttcaaccttcctgtccttctgcaatttagtgatgcct
ctatttgctagcttttttggttggttgcttcttggagaaagtttccctcctgggctattg
tttgctgtaggttttatggtgttgggttgtcggcttatttaccatgaggaatttcgccaa
ggatatgtgctgacttcagagtaa

DBGET integrated database retrieval system