KEGG   Clostridium tetani E88: CTC_00243Help
Entry
CTC_00243         CDS       T00112                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00450  Selenocompound metabolism
ctc00970  Aminoacyl-tRNA biosynthesis
ctc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CTC_00243
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTC_00243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctc01007]
    CTC_00243
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctc03016]
    CTC_00243
Enzymes [BR:ctc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CTC_00243
Amino acid related enzymes [BR:ctc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CTC_00243
Transfer RNA biogenesis [BR:ctc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CTC_00243
 Prokaryotic type
   Other AARSs
    CTC_00243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD zf-Mss51
Motif
Other DBs
NCBI-ProteinID: AAO34890
UniProt: Q899D9
Position
211425..213350
Genome map
AA seq 641 aa AA seqDB search
MNKKTFYITTPIYYPSAKLHIGNTYTTVAADALARFKRLTGHDVLFLTGTDEHGQKIQRV
AEEKGLKPKEYLDNMVDSIKELWKSMNISYDKFIRTTDDYHIESVQKIFKKLYEQGDIYK
GEYEGWYCTPCESFWTESQLDDHNCPDCGRPVEKTKEEAYFFKMSKYADRLIKYIEENPH
FIQPESRKNEMLNNFLKPGLQDLCISRTSFDWGIPVSFDNKHVIYVWIDALSNYITALGY
NSDNQELLEKFWPANVHLVGKDILRFHTIYWPIMLMALGIELPKQVFGHGWLLVDGGKMS
KSKGNVVDPVVLVDHFGEDTVRYYLLREIPFGSDGLFNNELFIKKINSDLANDLGNLLSR
TVAMVQKYFNGIMPAPIAKEPIDDELINLALDTREKVENNMEKLKIPEVLDEIWTLIGRA
NKYIDETTPWILAKDEDKKDRLGTVLYNLSETLRIISVLISAFIPKTSERINEQLNVDLT
TWDSIASFDGTKAGTKVVKGDALFPRIDVEAKIEELNSLKEKKEKKEIKPIKEEITIDDF
DKIDLRVVKVISCEPVKGAKKLLKLKVDLGGEERQVISGIAQYYKPEELVGKSVVLVANL
KPAKLRGELSQGMILAAATDDDSKLFTVSIPGELPTGSQVR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaactttttacattactacaccaatatactatccatcagctaaattgcat
attgggaatacttatactacagttgcagcagatgcattagctaggtttaaacgattaact
gggcatgatgtattattcttaactggaacagatgaacatgggcaaaagattcagagggta
gcggaagaaaagggattaaaacctaaagagtatttagataatatggttgacagcataaaa
gaattatggaaatcaatgaatataagctacgataaatttataagaactacagatgattat
catatagaatctgtacaaaaaatattcaaaaagttatacgaacaaggagatatatacaag
ggtgaatatgaaggatggtattgtacaccttgtgaatctttctggacagaatcacaacta
gatgatcacaattgtcctgattgtggaaggcctgtagaaaagacaaaggaagaagcatat
ttcttcaagatgtctaaatatgcagatagactaattaaatatatagaagaaaatccccat
tttatacaaccagaatcaagaaaaaatgaaatgttaaataattttttaaaaccagggttg
caagatttatgtatttcaagaacctcatttgactggggtatacctgtaagctttgataat
aagcatgttatatatgtttggatagatgctttatctaactatataacagcattaggatac
aatagtgataatcaagaactattagaaaagttttggccagcaaatgtacatttagttgga
aaagatatattaagattccatacaatatattggcctattatgcttatggcattgggaatt
gaactaccaaagcaagtatttggtcatggatggcttttagttgatggtggaaaaatgtct
aaatcaaaagggaatgttgtggatccagttgttttagtagatcattttggtgaagataca
gttagatattatcttttaagagaaatcccatttggatcagatggattatttaataacgaa
ttattcataaagaaaataaattctgatttagcaaatgacttaggaaacttactttcaaga
actgtagctatggtacaaaaatatttcaacgggataatgccagcacctatagccaaagaa
cctattgacgatgaacttataaatttagctttagatactagagaaaaagttgaaaataat
atggaaaaattaaaaataccagaagtattagatgagatttggacacttataggaagagca
aataaatatatagatgaaacgactccttggatacttgctaaagatgaagataaaaaggac
agactaggaactgtattatataatctatcagaaactttgagaatcatttcagttcttata
tctgcattcataccaaagactagcgaaagaataaatgaacaattaaatgtagatttaact
acttgggatagtatagcttcctttgatggcactaaggctggtacaaaagtagtaaaaggt
gatgcattattcccaagaatagatgtagaagctaaaattgaagaacttaatagtctaaaa
gagaagaaggaaaagaaagaaattaaacctataaaagaagaaataactatagacgatttt
gataaaattgacttaagagtagtaaaggtaatttcttgtgagccagtaaaaggtgcaaag
aaacttttaaaattaaaagtggatttaggtggagaagaaagacaagtaatttcaggaatt
gctcaatattataaaccagaagaactagtaggtaagtctgtggttttagttgcaaattta
aagccagcaaaattaagaggagaattatcccaaggaatgatattagcagctgctacagat
gatgatagtaagttatttactgtgagtattccaggtgaactaccaacaggaagtcaagtt
agataa

DBGET integrated database retrieval system