KEGG   Clostridium tetani E88: CTC_00312Help
Entry
CTC_00312         CDS       T00112                                 

Definition
(GenBank) acetyl-coA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00071  Fatty acid degradation
ctc00280  Valine, leucine and isoleucine degradation
ctc00310  Lysine degradation
ctc00362  Benzoate degradation
ctc00380  Tryptophan metabolism
ctc00620  Pyruvate metabolism
ctc00630  Glyoxylate and dicarboxylate metabolism
ctc00640  Propanoate metabolism
ctc00650  Butanoate metabolism
ctc00900  Terpenoid backbone biosynthesis
ctc01100  Metabolic pathways
ctc01110  Biosynthesis of secondary metabolites
ctc01120  Microbial metabolism in diverse environments
ctc01130  Biosynthesis of antibiotics
ctc01200  Carbon metabolism
ctc01212  Fatty acid metabolism
ctc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTC_00312
   00630 Glyoxylate and dicarboxylate metabolism
    CTC_00312
   00640 Propanoate metabolism
    CTC_00312
   00650 Butanoate metabolism
    CTC_00312
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CTC_00312
   00072 Synthesis and degradation of ketone bodies
    CTC_00312
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTC_00312
   00310 Lysine degradation
    CTC_00312
   00380 Tryptophan metabolism
    CTC_00312
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTC_00312
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTC_00312
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTC_00312
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctc04147]
    CTC_00312
Enzymes [BR:ctc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CTC_00312
Exosome [BR:ctc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTC_00312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAO34954
UniProt: Q898X5
Position
294440..295615
Genome map
AA seq 391 aa AA seqDB search
MKEVVIVSAVRTAMGKFGGTLKDVPAVELGATVIKEAINRAGIKPEIIDEVIMGNVIQAG
LGQSPGRQAAVKAGIPVEVPAFTLNKVCGSGLRAVGLAAQMIKAGDADVVIAGGMENMSA
APYVLPNARWGQRMFDGKMVDTMVKDGLWESFNDYHMGMTAENIAEKWELTREMQDEFAC
ASQNKAEKAIKEGKFKDEIVPVVIKTRKGEVVFDTDEFPRFGATVESLAKLKPAFKKDGT
VTAGNASGINDGAAALVIMSAEKAEELGLKPLAKIASYGSKGLDPAYMGYGPVGATKVAL
EKAGWKVEDLDLIEANEAFASQSLAVAKDLGFDMEKVNVNGGAIALGHPVGCSGARILVT
LLHEMQRRDSKKGLATLCIGGGMGTALLVER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttgttattgttagtgcagttagaactgccatgggtaaatttggaggaact
ttaaaagatgtacctgcagttgaattaggtgctacagttattaaagaagcaataaacaga
gcgggaattaaacctgaaattatagacgaagttataatgggaaatgttatccaagcagga
cttggacaaagtccaggaagacaagcagctgtaaaagctggaatacctgttgaagtacca
gcatttactttaaataaggtttgcggatcaggattaagagcagttgggctagcagctcaa
atgataaaagctggagatgctgatgtagtaatagctggtggaatggaaaacatgtctgca
gcaccatatgttttaccaaacgctagatggggacaaagaatgtttgatggtaaaatggta
gatactatggtaaaggatggtttatgggaatcattcaatgattatcatatgggaatgaca
gcagaaaacatagcagagaaatgggaattaacaagagaaatgcaagatgagtttgcatgt
gcttcacaaaataaagctgaaaaagctattaaagaaggaaagtttaaagacgaaatcgtt
ccagtagttataaaaactagaaaaggtgaagttgtatttgatacagatgagttcccaaga
tttggtgctactgtagaatcattagcaaagttaaaaccagcatttaaaaaagatggaaca
gttacagcaggaaatgcatcaggtataaatgatggtgcagctgcgttagttataatgagt
gcagaaaaagctgaagaactaggattaaaaccattagctaagatagcttcctatggttca
aaaggattagacccagcttatatgggatatggaccagtaggtgcaacaaaagttgctctt
gaaaaagctggatggaaagtagaagacttagatttaatcgaagctaatgaagcttttgcg
tcacaaagtttagctgttgctaaagatctaggatttgatatggaaaaagtaaatgttaat
ggtggagctatagcacttggacatccagtgggatgctctggagcaagaatattagttaca
ttactacatgaaatgcaaagaagagattctaaaaaaggtttagctactctttgcataggt
ggaggaatgggaacagctcttcttgtagaaagataa

DBGET integrated database retrieval system