KEGG   Clostridium tetani E88: CTC_00888Help
Entry
CTC_00888         CDS       T00112                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
ctc  Clostridium tetani E88
Pathway
ctc02020  Two-component system
ctc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ctc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTC_00888
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    CTC_00888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ctc02035]
    CTC_00888
Bacterial motility proteins [BR:ctc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    CTC_00888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP sCache_3_2 Sigma_reg_N Rx_N Mobilization_B
Motif
Other DBs
NCBI-ProteinID: AAO35481
UniProt: Q896V9
Position
941464..943563
Genome map
AA seq 699 aa AA seqDB search
MREGIKIKSLKNKLVTISIFLVAIPVCLSIFISNYYMNKNLRPHIHEDHNILSNTIANGV
ADYMTKAYALTEELISNDYVREFNAEKQNLAVKDAIKRNPYFDLFCIQNMKGDQTARSRG
HLANRADRWWFKQSVKTKKPFVSKSYLTVNDNSEAINSIIFPIIDNKGQMRGVMDADLKL
DELQKMVEKYSTDNTYAYVIDGNGAVIAHPNKEKVQEIYNYKTLQKTVRQKDSSGKVIKD
KNDVPVTKTETIEVVDKLKEIVGLALTGKHGIVEYKDKDGEKVISSYGTINLPGDSDNWA
VITTQKEKDAFAMIYDIRNRIMIVGFIVLLLAIILSYIVSARLIKPLTNLSELTQRAAKG
DLTVKSDYHSEDEIGALSISFNNMIDNMKALIFNIKEVTEVVTNATESLLASTQQTSSSI
NEVAESMTNVAVDIEKGSENAKDGVKSATDLSKELDSVSKKIVESEESSKNVYNISNNGF
EVIRKLEEKNERSSVVSREVTEVINSLSEKANNIGTIVETINSISEETNLLALNAAIEAA
RAGEAGKGFSVVAEEVRKLSENTAESTNNVKSIISNIQKDIKLAQGTIKQIEEVGIEQNE
AVNITKDTFKEINTSIEGIVEKINTISESLFSVDSCKTNLISVVEQVSFMAEGVAEATQN
VCGATEEQNAEMEQISALAEDLNNMTQKLIGEVKSFKIE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgagggaggggattaaaatcaaatctttaaaaaataagcttgtgacaatatccatattt
ttagtagctattcctgtctgtttatctatttttatttctaattattatatgaataaaaat
cttagacctcatatacacgaagatcataatatactatctaatacgatagctaatggtgta
gcagattatatgactaaggcctatgctttaacagaagaattgataagtaatgattatgtt
agagagtttaatgccgagaagcaaaatttggctgtaaaggatgccataaagagaaatcca
tattttgacttgttttgtatacagaacatgaaaggagatcagacagctagaagtaggggg
catttagccaatagagcagatagatggtggtttaaacaaagtgtcaaaaccaaaaagcct
tttgtaagtaaatcttatttaacggtaaatgataatagtgaagctataaattccatcata
tttcccattatagataataaagggcagatgcgaggagtaatggatgcagatctaaaactt
gatgagcttcaaaaaatggttgaaaaatatagtacagataatacttatgcatatgtaata
gatgggaatggggcagttatagcacatcctaataaagaaaaagtccaagaaatatataat
tataaaacattacaaaaaactgtcagacaaaaggattcatcaggtaaagtgataaaagat
aaaaatgatgtaccagtaacaaaaacagaaactatagaagtagtagataaattaaaggaa
atagtagggctggcattaaccggtaaacatggaatagtagaatataaagataaagatgga
gaaaaagtaataagttcttatggaactataaatcttccaggagattcagataattgggcg
gtaataacaacccaaaaagaaaaagacgcttttgcaatgatatatgatattagaaatagg
attatgatagtaggatttatagtattactattagccataatattatcttatatagtatct
gcaagacttattaaacctttaaccaatttatcagaattaacacaaagagcggcaaaggga
gatttgacggttaaatcagactatcattcagaagatgaaataggtgcattaagtatatct
tttaataatatgatcgataatatgaaagcacttatatttaatataaaagaagttacagaa
gttgtaacaaatgcaactgaaagtttattagcttctactcagcagacatcaagttctata
aatgaagttgctgaaagtatgaccaatgtagcagtagatatagaaaaaggatcagaaaat
gcaaaagatggagttaaatcagccactgatttatcaaaggaattggactcagtttctaaa
aagatagtagaaagtgaagaatcctctaaaaatgtatataacatatctaataatgggttt
gaagttattagaaagttagaagagaaaaatgaaagaagtagtgtagtttcaagggaagtt
acagaagttataaattctttaagtgaaaaagcaaataatataggaacaatagtagaaact
ataaactctatttcagaagaaacaaatttactagctttaaatgcagccatagaggcagca
agagcaggagaagcaggaaaaggattttcagtagtggcagaagaagtaaggaaattatca
gagaatacagcagaatcaactaataatgtaaaatctattataagcaatatacaaaaagat
attaaacttgctcaaggtacaattaaacaaatagaggaagtgggaatagaacaaaatgaa
gcagttaatattacaaaagatacatttaaagaaataaatacttcaatagaaggaattgta
gaaaaaattaatacaatatctgaaagcttatttagtgttgatagctgtaagactaattta
atatcagtagtagaacaggtatcctttatggcagaaggtgtagctgaagctacacaaaat
gtatgtggagctacagaagagcaaaatgctgaaatggaacaaataagtgctttagcagaa
gatttaaataatatgacacaaaagttaataggagaagttaaaagctttaagatagaataa

DBGET integrated database retrieval system