KEGG   Clostridium tetani E88: CTC_01763Help
Entry
CTC_01763         CDS       T00112                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00220  Arginine biosynthesis
ctc00330  Arginine and proline metabolism
ctc01100  Metabolic pathways
ctc01110  Biosynthesis of secondary metabolites
ctc01130  Biosynthesis of antibiotics
ctc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CTC_01763
   00330 Arginine and proline metabolism
    CTC_01763
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CTC_01763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Pox_RNA_Pol_19
Motif
Other DBs
NCBI-ProteinID: AAO36294
UniProt: Q893P8
Position
1874307..1875203
Genome map
AA seq 298 aa AA seqDB search
MNINLIGVPLFYGSDIEGVEFGPKKLREKNIVEVLSKYHRVYDFGDLYVPEENSLNKYSY
HPKMKYLKPIIQVNTNLAQEVYASLSSKSFPLILGGDHSLALGSISGVSKYYKNFAVIWV
DAHGDINSYLTTHTGNVHGMPLAAAMGVGYNDLTNLYFHGTKVKPENVFIIGARDLDEGE
CELIEEKNLNVYSTEDIKYKGISYVLEDILSKLDAQGIDAIHLSFDIDCIDPDFVPGTGT
PVKDGLSTGEAKTLLKSLCESRLIKSMDFVELNPRLDKDDSTSNLCIELLDWCFKYIK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaatttaattggtgttccattattctatggttccgatattgaaggagtagaa
tttggtcctaaaaaattaagagaaaaaaatatagtagaggttttaagtaaatatcatagg
gtatacgattttggtgatttatatgttccggaggaaaactcactaaataaatattcctat
catccaaaaatgaaatatttaaaaccaataattcaggtaaataccaatttagctcaggag
gtatatgcttctcttagttctaaaagtttccctcttatattaggcggagatcattcatta
gcccttggaagtatttctggtgttagtaaatactataaaaattttgcagtaatatgggta
gatgctcatggagatataaactcttacttaactactcatactggaaatgtgcatggtatg
cctcttgcagctgccatgggtgttggatataatgacctaacaaatctttatttccacggt
accaaagttaaaccagaaaatgtatttataataggtgctagagatttagatgagggtgaa
tgtgaactaatagaagagaaaaatttaaatgtatattccactgaggacattaaatataaa
ggtatctcctatgtactggaagatattctttctaaattggatgctcaggggattgatgct
atacatttaagttttgatatagattgtatagatccagactttgttcctggtacaggtaca
cctgtaaaagatggactttctacaggtgaggctaaaaccttattaaaatccttatgtgaa
agtagattaattaaatctatggattttgttgaattaaatcctagattggataaagatgat
agtacatctaatctatgtattgaactgctagactggtgttttaagtatatcaaataa

DBGET integrated database retrieval system