KEGG   Clostridium tetani E88: CTC_02388Help
Entry
CTC_02388         CDS       T00112                                 

Definition
(GenBank) nucleoside-triphosphatase / Ham1P-like protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ctc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CTC_02388
Enzymes [BR:ctc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     CTC_02388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like DUF3236
Motif
Other DBs
NCBI-ProteinID: AAO36861
UniProt: Q891I4
Position
complement(2525059..2525664)
Genome map
AA seq 201 aa AA seqDB search
MKTVLLATNNENKVNEIKDILCELNLKVVSLKEVGINVEVEEDELTFMGNALKKALTLYN
MIDDKKYMVLADDSGLSVDVLGGAPGVFSARYAGEHGNSKANNEKLLEDMKGLKNRKGKF
ICAMALVIDKDNIIKVQGEVEGSIGYEEKGDNGFGYDPLFFVSKYNMTFAEMDKDIKNSI
SHRRDALNKIKEKLKSYIEDK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttctattagcaactaataatgaaaataaagtaaatgaaattaaggatata
ctttgtgaattaaacttaaaggttgtatcattaaaagaagtaggtattaatgttgaagta
gaagaagatgagcttacttttatgggaaatgcattgaagaaagcattaactttatataat
atgatagatgataaaaaatacatggtattagcagatgattcaggattgagtgtggatgtt
ttagggggagcacctggagttttttctgctagatatgcaggagaacatggaaattctaaa
gcaaataatgaaaagttattggaagatatgaagggcttgaaaaatagaaaaggtaaattt
atatgtgccatggctttagttatagacaaggataatattataaaagttcaaggagaagtt
gagggaagtattggttacgaggaaaaaggagataacggttttggatatgatccactattt
ttcgtatctaaatataatatgacttttgcagaaatggacaaggatattaaaaattctata
agtcatagaagagatgctttaaacaaaataaaagagaagttgaaaagttatatagaagac
aaataa

DBGET integrated database retrieval system