KEGG   Chlamydia trachomatis D-EC: CTDEC_0185Help
Entry
CTDEC_0185        CDS       T01900                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ctd  Chlamydia trachomatis D-EC
Pathway
ctd00030  Pentose phosphate pathway
ctd00480  Glutathione metabolism
ctd01100  Metabolic pathways
ctd01110  Biosynthesis of secondary metabolites
ctd01120  Microbial metabolism in diverse environments
ctd01130  Biosynthesis of antibiotics
ctd01200  Carbon metabolism
Module
ctd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ctd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ctd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CTDEC_0185 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTDEC_0185 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctd04147]
    CTDEC_0185 (zwf)
Enzymes [BR:ctd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CTDEC_0185 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CTDEC_0185 (zwf)
Exosome [BR:ctd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CTDEC_0185 (zwf)
  Exosomal proteins of colorectal cancer cells
   CTDEC_0185 (zwf)
  Exosomal proteins of bladder cancer cells
   CTDEC_0185 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADI50861
Position
206599..208122
Genome map
AA seq 507 aa AA seqDB search
MEEIKDFGPTLPACPPCIVVIFGATGDLTSRKLFPALYNLTKEGRLSENFVCVGFARRPK
SHEQFREEMKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSVLKAYLEQLDQQ
YGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVNLETAREL
QQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYIDHVQISVSESIGI
GSRGNFFEKSGMLRDMVQNHLTQLLCLLTMEPPSEFFSEEIKKEKIKILKKILPIREEDA
VRGQYGEGIVQDVSVLGYREEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPK
RTTDIAVIFKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVRPV
KMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLLEKWSQVRPIF
PNYMAGSLRPQEADELLSRDGKAWRPY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaattaaagactttggccccacattaccagcctgtcctccctgtatcgtggtt
atttttggtgctacaggagacttgacctctaggaagctctttcctgctttatacaattta
acaaaggaaggacgtctatccgaaaactttgtttgtgttgggtttgctaggcgacctaag
tctcatgagcaatttcgcgaagaaatgaagcttgccgttcagcatttctctcactcatcg
gaaatagatattcgagtttgggaaagtctggaaaatagaatcttttaccaccaagctaat
ttttctgatgccgaaggctactctgttctgaaagcttatttggagcaactagatcaacaa
tatggaacacaagggaatcgtcttttttatttatcaacaccaccagattatttccaggaa
atcatccgcaatttaaatcggcatcagctattctatcatgaacaaggagcacaacagcct
tggtctcggctaattatagaaaagccttttggagttaatttagaaacagctcgagagctt
caacaatgcattgatgccaatattgatgaagagtcggtttatcgaatagaccattattta
ggaaaagaaacggttcaaaacattctgactattcgttttgctaatactctctttgagtct
tgctggaattctcagtacatagatcatgtgcaaatcagcgttagcgaatcaattggtata
ggatctcgagggaatttcttcgaaaagtcgggcatgctacgagacatggtacagaatcat
ttgacgcagctgctatgtctactgactatggaacctccttctgaatttttttccgaagaa
ataaaaaaagaaaaaattaaaattctaaagaaaattcttcctatccgcgaagaagatgct
gttcgtggccagtatggtgaagggattgtgcaagatgtttcagttctgggctatcgggag
gaagaaaatgtcgatccgaattcttcagtagaaacctacgttgcgttaaaattatttatc
gacaatcctcgctggaaaggggttcccttttacttacaagcagggaaacgtcttcctaaa
agaacaacagatatcgctgtgatctttaaaaaatccagctacaatttattcaatgcagag
aattgtcctttgtgtccgttagagaatgatttacttattattcgtattcaaccggatgaa
ggtgttgcgttacaatttaactgcaaggttccaggaacaaataagctcgtacgtcctgta
aaaatggacttccgttacgacagctattttaatactgttactcccgaagcttatgaacgg
ttactgtgcgactgtatccttggggacagaacgctattcactagcaatgaagaagtctta
gcatcttgggaactattttctcctctattagaaaaatggtctcaagtacgccctatattc
cctaactatatggctggatctttacgtcctcaagaagctgatgaactattatctagagat
ggaaaagcttggcggccctattaa

DBGET integrated database retrieval system