KEGG   Chlorobaculum tepidum: CT0051Help
Entry
CT0051            CDS       T00088                                 

Gene name
bioF-2
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00780  Biotin metabolism
cte01100  Metabolic pathways
Module
cte_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cte00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CT0051 (bioF-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cte01007]
    CT0051 (bioF-2)
Enzymes [BR:cte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CT0051 (bioF-2)
Amino acid related enzymes [BR:cte01007]
 Aminotransferase (transaminase)
  Class II
   CT0051 (bioF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1 DegT_DnrJ_EryC1 SHMT Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 1006469
NCBI-ProteinID: NP_660957
CyanoBase: CT0051
CYORF: CT0051
UniProt: Q8KGB7
Position
complement(48892..50112)
Genome map
AA seq 406 aa AA seqDB search
MSGGFTNAGQVEPPIVADIAVELAKLKAKQRFRSIPATGERSGRFVTVGGRKLLNLSSND
YLGLGADRELFSSFIAQIRDDRFDDGRFAMTSSSSRLLTGHHPVCDQLESAIAAAYGSET
ALVFNSGYHANTGILPALATRHDLILSDRLNHASIIDGLRIADADYRRFRHADYDHLEEQ
LETAARECYRQIFIVTESVFSMDGDLADLRRLVKLKRRFKAVLIVDEAHGAGVFGERGLG
LCEALGVTNEIDIIVGTFGKSLASAGAYAVMRGLFREYLVNTMRTLIFTTALPPMTLAWS
LATFTKQLTMQRERDHLLGLAATLRGSLREAGFDVPGESHIVPVVLGEDRTAVEMAGALR
EAGFHALPVRPPTVPENSSRLRFSLRADLTSGDIAALAETMKRGAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggatttacgaatgcgggccaggtcgagccgccgattgtggccgacatcgcg
gtggagcttgcgaagctcaaggcgaagcagcgcttccgctcgattcccgccaccggcgag
cggagcgggcgcttcgtcactgttggcggtcgcaagctgctgaacctctcctcgaacgac
tatctcggcctcggcgctgaccgcgagctgttcagctcgttcatcgcacagattcgagat
gatcggttcgacgacggacgcttcgccatgaccagctcctcgtcgcgcctgctgacgggc
caccacccggtctgcgaccagctcgaatcggcgattgccgccgcctacggcagcgaaacg
gcgctcgttttcaacagcggctaccacgccaacaccggcattctgcccgcactcgccacc
cgccacgacctgatcctcagcgaccgcctcaaccacgccagcatcatcgacggcctgcgg
atcgccgacgccgattatcgccgcttccgccacgccgattatgaccacctcgaagagcag
ctcgaaaccgccgccagagagtgctaccggcagattttcatcgtcaccgaatcggtcttc
agcatggacggcgaccttgccgacttgcgtcgtctggtcaagctgaagcgtcgtttcaag
gcggtgctgatcgtggacgaagcgcacggcgcaggcgtcttcggcgagcggggcctcggc
ctctgcgaagcgctcggcgtgacgaatgagatcgacatcatcgtcggcactttcggcaag
tcactcgcctccgccggggcctacgctgtcatgcgcggcctctttcgcgagtacctcgtc
aacacgatgcgcaccctgatcttcaccaccgccctcccgccaatgacgctcgcttggagc
ctcgccaccttcacgaaacaactcacgatgcagcgggagcgcgaccatctgctcggtctc
gcggcgaccttgcgcggcagcctccgcgaggcgggattcgacgtacccggcgagagccac
atcgtaccggtggtgctgggcgaagatcgcacagcggtcgagatggccggagcgctgcgc
gaagcgggtttccacgcgctgccggtacgcccgccgacggtacccgaaaacagctcgcgt
ctccgcttttcactccgcgccgacctgacgagcggcgacatcgccgcccttgccgaaacc
atgaaaagaggcgcggcatga

DBGET integrated database retrieval system