KEGG   Chlorobaculum tepidum: CT0280Help
Entry
CT0280            CDS       T00088                                 

Gene name
lpxB
Definition
(RefSeq) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00540  Lipopolysaccharide biosynthesis
cte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cte00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CT0280 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cte01003]
    CT0280 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:cte01005]
    CT0280 (lpxB)
Enzymes [BR:cte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     CT0280 (lpxB)
Glycosyltransferases [BR:cte01003]
 Polysaccharide
  Bacterial polysaccharide
   CT0280 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:cte01005]
 Lipid A
  CT0280 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-GeneID: 1007837
NCBI-ProteinID: NP_661184
CyanoBase: CT0280
CYORF: CT0280
UniProt: Q8KFP2
Position
291176..292324
Genome map
AA seq 382 aa AA seqDB search
MTCRRKLFVLAGEVSGDLHAAGPVRELLAARPDTKVFGVGGRKLAELGAELLYTTDQMSI
MGFVEVLKHAAFLRKAIRELKAAIVREKPDAALLIDYPGMNLHLAAFLKKQGVPVIYYIS
PQVWAWKERRVEKIRACVDRLLVIFDFEVEFYRRHGIDAEFVGNPVVEELAELKFAPKPE
FLARMGIDSDARIVGLLPGSRKQEIEKIFPEMLGAAKHIGEQGKTVFLLGRSPHIDPALY
DRYLREAGIEPLDCTSYEVMRYSDLELVTSGTATLESLCFAVPMVVLYKTSPLNYFIGKR
LVKLHNIALANIVACGLLSEKQAVPELIQHEANAGNISRKVLEILCNDAVSSSMRRELRE
ARGRLSSDSPSRHVAAVLFEYL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgccgaaggaagcttttcgttctggccggtgaggtctctggcgaccttcatgcg
gcaggccccgtgcgcgagctgctcgcggcccggcccgatacgaaagtgttcggcgtcggc
ggacgcaagctggccgaacttggtgcggaactgctttacaccaccgaccagatgagcatc
atgggttttgtggaggtgctcaaacacgcggcgttcctgcgcaaggcgatccgcgaactc
aaggcggccatcgtgcgtgaaaagcccgatgcggcgctcctcatcgactatcccggcatg
aacctgcatctggcggcttttctgaagaaacagggggttccggtgatctactacatctcc
ccgcaggtgtgggcgtggaaggagcggcgggtcgagaagattcgcgcctgcgttgaccgg
ttgctggtgattttcgacttcgaggtggagttttaccgtcgccatggcatcgatgcggag
ttcgtcggcaatccggttgtcgaggagctggcggagctgaagttcgcgcccaagcctgag
ttcctcgcgcggatgggcatcgattccgacgcccgcatcgtcggactgctgccaggcagc
cgcaagcaggaaatcgagaagattttccccgaaatgctcggcgcggcaaaacacatcggc
gagcagggcaaaaccgtcttcctgctcggcaggtcgccgcacatcgatccagcgctctac
gatcggtacctccgagaggcgggcatcgagccgctcgactgcacgtcgtacgaagtaatg
cggtacagtgatctggagctggtcacctccggtacggcgacgctcgaatcgctttgcttc
gccgtgccgatggtggtgctctacaagacctcgccgctgaactatttcatcggcaagcgg
ctggtgaagctccacaacatcgcgctggccaacatcgttgcctgcggattgctgtcggaa
aaacaggccgtgccagagctgatccagcacgaggcgaacgccggaaacatcagcaggaag
gtgctggaaattctttgtaatgacgccgtatcgtcgtcgatgcggcgcgaactcagggag
gcgcgggggcggctttcctcggattcgccctcacgccatgtggccgccgtgctgtttgaa
tatttatga

DBGET integrated database retrieval system