KEGG   Chlorobaculum tepidum: CT0399Help
Entry
CT0399            CDS       T00088                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00010  Glycolysis / Gluconeogenesis
cte00260  Glycine, serine and threonine metabolism
cte00680  Methane metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01130  Biosynthesis of antibiotics
cte01200  Carbon metabolism
cte01230  Biosynthesis of amino acids
Module
cte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT0399 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CT0399 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0399 (gpmA)
Enzymes [BR:cte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CT0399 (gpmA)
Membrane trafficking [BR:cte04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CT0399 (gpmA)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CT0399 (gpmA)
  Exosomal proteins of melanoma cells
   CT0399 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 1008102
NCBI-ProteinID: NP_661303
CyanoBase: CT0399
CYORF: CT0399
UniProt: Q8KFC8
Position
412646..413389
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESQWNRENRFTGWVDVDLSEKGREEARTAGQLLKDEGFVFDLAYTSVLKR
AIRTLWTVLDEMNLMWIPVTKNWRLNERHYGALQGLNKAETAQRHGDEQVLIWRRSYDTP
PPALTESDEFWPGKDPRYASLSSQELPATECLKDTVARFLPYWHETIAPQIRDGKNVIIT
AHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQEELKKKVEV
VVKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttgtcctgctgaggcacggcgaaagccagtggaaccgggagaaccgtttc
accggatgggtggatgttgatctttccgagaaaggaagagaagaggcgagaaccgctggc
cagctgctcaaggatgagggtttcgtgtttgacctcgcctacacttcggtgctcaagcgc
gccatcaggacgctctggacggtgctcgacgagatgaatctcatgtggattcccgtcaca
aaaaactggcgtctcaacgaacgccattacggagcattgcaggggctcaacaaggcagag
actgcccagcgccacggcgacgagcaggtgctgatctggcgccgcagctacgacacgccg
ccaccggctctcaccgagagcgatgagttctggccgggcaaggacccgcgctatgcttcg
ctgtcctctcaggaactgcctgccacggagtgcctgaaggatacggttgcgcgcttcctt
ccctactggcacgagactattgcaccgcagattcgcgatggcaagaatgtcattattaca
gctcacggtaattcgctcagggcgctggtcaaatatctcgacaacatttcggatgaggat
atcgtcggtctgaacattcctaccggtattccgctggtgtacgagcttgacgacgatctc
aagccgctgaagagttactatctgggcgaccaggaggagctgaagaaaaaggtggaggtc
gtcgtcaaacagggcaaagcctga

DBGET integrated database retrieval system