KEGG   Chlorobaculum tepidum: CT0521Help
Entry
CT0521            CDS       T00088                                 

Gene name
trpB-1
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00260  Glycine, serine and threonine metabolism
cte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01130  Biosynthesis of antibiotics
cte01230  Biosynthesis of amino acids
Module
cte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CT0521 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT0521 (trpB-1)
Enzymes [BR:cte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CT0521 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1006194
NCBI-ProteinID: NP_661421
CyanoBase: CT0521
CYORF: CT0521
UniProt: Q8KF11
Position
complement(527030..528232)
Genome map
AA seq 400 aa AA seqDB search
MKQKVIYSAPDEFGHFGTFGGKFIPETLVKNAADLEEEYLKAKNDPEFHQTLDNLLRHYV
GRPTPLYHASRLSEKQGGAQIWLKREDLCHTGAHKINNALGQVLLAKRMGKKRIIAETGA
GQHGVATATVCALFGLDCIVYMGEEDIRRQAPNVARMKLLGTEVRPVTAGSRTLKDATSE
AIRDWMNNPEETFYIVGSVIGMHPYPMMVRDFQSVIGRETRQQVLDQAGRLPDVIVACVG
GGSNAIGMFYEFLPDAKEVELIGVEAAGEGLEGKHAASLTKGEIGVLHGSMMKLLQDEYG
QVQEAHSISAGLDYPGVGPEHCYLQKLGLVCYTSTTDKEALAALDALAKTEGIICALESA
HAVHYAMKRAAEMPKESIIVVNLSGRGDKDMGTIMQELKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaggttatctactccgcacccgatgaattcggccacttcggcaccttcgga
ggcaaattcattcccgaaaccctggtcaaaaacgccgccgatctcgaagaggagtacctc
aaggcgaaaaatgatccggagttccaccaaacgctcgacaacctgcttcgccactacgtt
ggccgcccgacgccgctctatcacgcctcgcggctcagcgaaaagcagggcggcgcccag
atctggctcaagcgcgaagacctctgccacaccggcgcgcacaagatcaacaacgccctc
ggccaggtgctgctggccaaacggatgggcaaaaagcgcatcatcgccgaaaccggcgcg
ggccagcatggcgtggcaacggccaccgtctgcgcgctcttcggtctcgactgcatcgtc
tatatgggcgaagaggacatccgccgccaggctcccaacgtggcgcgcatgaagctgctc
ggcacagaggtgcgcccggtcacggcaggcagcagaacgctgaaggacgccaccagcgag
gcaatccgcgactggatgaacaatcccgaagagaccttctacatcgttggctcggtgatc
ggaatgcacccgtacccgatgatggtacgcgacttccagtcggtcatcggacgcgaaacc
cgccagcaggtgctcgatcaggccgggcgcttgcccgatgtgatcgtggcctgcgtcggc
ggcggcagcaacgccatcggcatgttctacgagtttttgccggatgccaaagaggtcgaa
ctgatcggcgtcgaagccgccggagagggactcgaaggcaagcacgccgcgtcgctgaca
aagggtgaaatcggcgtgctgcacggctcgatgatgaagctcttgcaggacgagtacggt
caggtgcaggaggcgcactcgatttcggcgggactcgactaccccggcgtcggtccggag
cactgctatttgcagaagctcggcctggtctgctatacctcgacgacagacaaggaagcc
ctcgcagcgctcgacgctctggccaaaaccgaaggcatcatctgcgccctcgaatcggct
cacgccgtgcattatgcgatgaaacgagccgccgaaatgccgaaagagtcgatcatcgtg
gtcaacctctctggccgcggcgacaaagacatgggtaccatcatgcaggagctgaagctg
taa

DBGET integrated database retrieval system