KEGG   Chlorobaculum tepidum: CT1275Help
Entry
CT1275            CDS       T00088                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00010  Glycolysis / Gluconeogenesis
cte00071  Fatty acid degradation
cte00350  Tyrosine metabolism
cte00625  Chloroalkane and chloroalkene degradation
cte00626  Naphthalene degradation
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01130  Biosynthesis of antibiotics
cte01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT1275
  Lipid metabolism
   00071 Fatty acid degradation
    CT1275
  Amino acid metabolism
   00350 Tyrosine metabolism
    CT1275
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CT1275
   00626 Naphthalene degradation
    CT1275
Enzymes [BR:cte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CT1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 1006632
NCBI-ProteinID: NP_662163
CyanoBase: CT1275
CYORF: CT1275
UniProt: Q8KCY2
Position
complement(1193454..1194470)
Genome map
AA seq 338 aa AA seqDB search
MVLERVVDLLHETQPLVLRELPVPEPGPGEILLRVATCGVCHTELDEIEGRTPPPRFPVI
PGHQVIGRVVACGDGVAGIETGSRRGVAWIYSSCGHCDLCRSGNENLCAEFSATGRDADG
GYAEYMVAPAAFTYSIPDVFSDAEAAPLLCGGAIGYRSLMLANLKDGQILGLTGFGASGH
QVLKLARYLYPKSPVFVFARSEKDCDFARSLGADWAGGTTDNSPSPCDSIIDTTPAWLPV
LSALERLRPGGRLVINAIRKESHDSELLAGISYERHLWMEKEIKSVANITRADVSAFLDI
AARMGLKPEVRSYPLEEANRVLLDLRHGKARGAAVLIP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggagcgggttgtcgatcttttgcacgagacgcaaccgctggttctgcgggag
ttgcccgttcccgagccggggccgggggagattctgttgagggtcgccacctgtggcgtc
tgccacacggagcttgacgaaatcgaggggcgcacgccgccgccgcgatttccggtgatt
ccgggacatcaggtcattgggcgggttgttgcctgcggcgatggcgtcgcgggcatcgaa
accggcagtcgacgcggggtggcgtggatttactcttcgtgtggtcactgcgacctctgc
cgctccggtaacgaaaacctctgcgcggagttcagcgcgacaggccgcgacgccgatgga
ggctacgcggagtatatggtggctccggcggccttcacctattccattcccgatgtgttc
tccgacgccgaggccgctccgctcctctgcggcggcgcgatcggctaccgttcgctgatg
ctcgcaaacctcaaagatggtcagattctcggcctgaccgggttcggcgcatcgggccat
caggtgctcaaactcgctcgctatctctatccaaaatctccggtcttcgtcttcgcccga
agcgaaaaagactgcgatttcgcccgctcgcttggcgcggactgggctggcggtaccaca
gacaactcgccgtcgccctgtgattccattatcgatacgacgcccgcctggttgccagtg
ctttcggcgctcgaacggcttcggcccggcggacggctcgtcatcaatgcgatccgcaag
gagtcgcacgatagcgagttgctcgcgggcatttcctacgaacggcacctctggatggag
aaggagatcaaaagcgtggccaacattacgcgggccgatgtgtcggcgttcctcgacatc
gccgcccgcatggggctgaagccggaggtgcggagctatccgctcgaagaggccaaccgt
gtgctgctcgatctgcgtcacggaaaagcccgcggtgctgcggtactcattccataa

DBGET integrated database retrieval system