KEGG   Chlorobaculum tepidum: CT1402Help
Entry
CT1402            CDS       T00088                                 

Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cte  Chlorobaculum tepidum
Pathway
cte03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cte00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CT1402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cte03400]
    CT1402
Enzymes [BR:cte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CT1402
DNA repair and recombination proteins [BR:cte03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CT1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 PhoH Helicase_RecD PIF1 NTPase_1 HHH HHH_2 AAA_29 RsgA_GTPase T2SSE AAA_16 AAA AAA_23 AAA_5 cobW NACHT AAA_22 AAA_28 ABC_tran AAA_7 MeaB DUF2075 MobB AAA_18 PRK AAA_15
Motif
Other DBs
NCBI-GeneID: 1006361
NCBI-ProteinID: NP_662288
CyanoBase: CT1402
CYORF: CT1402
UniProt: Q8KCL3
Position
1315434..1317638
Genome map
AA seq 734 aa AA seqDB search
MQKPADSHEERLSGSVERVTFHSEESGFTVLRLRVAGQREPVAVVGLATSPAVGEFMECV
GTWQNDRTHGLQFKASKITPAQPTTLEGKERYLASGQVKGLGNFYAKKLIERFGDAVFEV
IENDPERLLEIPGIGRKRLDMVVKSWAEQKAIRDIMLFLQSHGIGTARAWKIYRRYREQA
IATITENPYRLSLDIEGIGFQTADAIATSLGVAKNSLMRAEAGISHVLGELSQNGHCAVP
EETLIDEASRLLQIDHPLVVEAVKNEKLTRRIVGETIDGVPCIFLESLHRAETGVASGLH
RLMRGPLPWNALDPHDALPWIEETTALELSPSQRSAVTLVLASKVSIITGGPGVGKTTIL
KAILSVLQREKVSVALCAPTGRAAKRLTESTGIEAKTIHRLLEFDPQAFDFKRGRGNPLD
ASFVVVDETSMVDVVLMQKLVAAIPDHAAVVFVGDVDQLPSVGPGAVLADMISSEAIPTV
RLTEIFRQAAESMIVVNAHRINQGDMPLTAEGEELSDFYVVKAASAEEIHDKVIQLVTER
IPKRFGLDAVKDVQVLTPMNKGGVGVHALNAELQAKLNPASEPKVTRFGTTFAPGDKVIQ
TVNNYDKEVFNGDIGLIEAIDPEAEIATAFFFDHHRAEYDFNDLDELSLAYATSIHKSQG
SEYPAVVIPLAMQHFTLLERNLIYTAVTRGRKLVVIVAEPKALTLAIKNCKSKRRLTGLV
QRLRESGKQSWQNL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacccgccgactcacacgaagagcgcctctccggttcagtcgagcgggtgact
tttcacagcgaggagtcgggcttcacggtgctgcgcctccgggtcgccgggcagcgtgag
ccggttgctgtggtaggcctcgcaacatcaccggcggttggagaattcatggagtgcgtc
ggcacgtggcagaacgaccgcacgcatggattgcagttcaaggcctcgaaaatcaccccc
gcacaacccactacactcgaaggcaaggaacgctacctcgcctccggacaggtgaaggga
ctcggcaatttctacgctaaaaagctgatcgagcgttttggtgacgccgtgttcgaagtg
atcgagaacgatccggagcggctgcttgaaatccccggcatcgggcgcaagcggctcgac
atggtcgtcaaatcgtgggccgagcagaaagcgatccgcgacatcatgctcttcctgcaa
tcgcacggcatcggtacagcgcgggcctggaagatttaccgccgctaccgcgaacaggcc
atcgcaacgatcaccgaaaacccgtaccgcctctcgctcgacatcgaaggcattggcttc
cagaccgccgacgccatcgccacgagcctcggcgtcgcgaaaaattcactgatgcgggcc
gaagcgggcatcagccacgtgctcggcgagctgtcgcagaacggccactgtgcggtgccg
gaagagacgctgattgacgaggcgtcgcgcctgctccagatcgaccatccgctcgtggtc
gaagcggtgaaaaatgaaaagctgacgcgccgcatcgtgggcgaaacgatcgacggcgtg
ccgtgcatcttcctcgaatcgctgcatcgcgccgaaacgggcgtcgcctccggcctgcat
cgcctgatgcgcggcccgctgccgtggaatgcacttgatccgcacgacgcgctgccgtgg
atcgaggagacgacagctctcgaactctcgccatcgcagcgcagcgcagtgacgctcgtg
ctggcgagcaaggtctcgatcatcaccggcgggccgggcgtcggcaaaacgacgatcctc
aaagcaatcctctcggtgctccagcgcgaaaaggtctccgtggcgctctgtgctcccacc
ggacgcgcggccaaacggctcaccgaatcgaccggcatcgaggccaagacgatccaccgc
ctgctcgaattcgacccgcaggcgtttgacttcaagcgcggacgcggcaacccgctcgac
gcctcgttcgtggtggttgacgaaacctcgatggtcgatgtggtgctgatgcagaagctc
gtggcggccatccctgaccacgcggcggtggtcttcgtcggcgacgtcgatcagctccca
tcggtcggtcccggcgcggtgctcgccgatatgatctcgtcggaggcgatcccgaccgtg
cggctcaccgaaatcttccggcaggccgccgagtcgatgatcgtcgtcaacgcccaccgc
atcaaccagggcgacatgccgctcaccgccgagggcgaggagctgtcggatttctacgtg
gtgaaggcggcctcggccgaggagattcacgacaaggtgatacagctcgtcacggagcgc
atcccgaagcgcttcggcctcgatgcggtcaaagacgtgcaggtgctcacgccgatgaac
aaggggggcgtcggcgtgcacgcgctgaacgccgagcttcaggcgaagctcaacccagct
tccgagccgaaggtcacgcgcttcggcaccaccttcgcgccaggcgacaaggtgatccag
acagtcaacaactacgacaaggaggtcttcaacggcgacattggcctcatcgaagcgatc
gacccggaggcggaaatcgcgacagccttcttcttcgaccaccaccgcgccgagtacgat
ttcaacgatctcgacgaactctcgctcgcctacgccacaagcatccacaaaagccagggt
tccgagtacccggctgtcgtcattccgctcgccatgcagcacttcacgctgctcgaacgc
aacctcatctacacggcggtcacgcgcggacgcaagctcgtggtgatcgttgccgagccg
aaagcgctcacactcgccatcaaaaactgcaagtcaaagcgccgcctgaccgggctcgtg
cagcggctcagagagtccgggaaacaaagctggcaaaatttgtaa

DBGET integrated database retrieval system