KEGG   Chlorobaculum tepidum: CT1444Help
Entry
CT1444            CDS       T00088                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00010  Glycolysis / Gluconeogenesis
cte00051  Fructose and mannose metabolism
cte00562  Inositol phosphate metabolism
cte01100  Metabolic pathways
cte01110  Biosynthesis of secondary metabolites
cte01120  Microbial metabolism in diverse environments
cte01130  Biosynthesis of antibiotics
cte01200  Carbon metabolism
cte01230  Biosynthesis of amino acids
Module
cte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CT1444 (tpiA)
   00051 Fructose and mannose metabolism
    CT1444 (tpiA)
   00562 Inositol phosphate metabolism
    CT1444 (tpiA)
Enzymes [BR:cte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CT1444 (tpiA)
Exosome [BR:cte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CT1444 (tpiA)
  Exosomal proteins of bladder cancer cells
   CT1444 (tpiA)
  Exosomal proteins of melanoma cells
   CT1444 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1005992
NCBI-ProteinID: NP_662330
CyanoBase: CT1444
CYORF: CT1444
UniProt: Q8KCH7
Position
complement(1356164..1356901)
Genome map
AA seq 245 aa AA seqDB search
MVGNWKMNNTIAESVDLATAIAEKVGADGVQCEVGIAPTFPALYEVCKVIEWSGIRLCAQ
NCHYESDGPFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNATVNLKVKKALAEGLSVI
LCVGETLDERERGVTGQIVTAQVVEGLIDVTDISKLVIAYEPVWAIGTGKTATKEQAQEV
HALIRAKVTELYGQKAADHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNADDFMAI
VEAAG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggcaactggaagatgaacaacaccatcgccgagtctgtcgatctggcaactgcg
attgccgagaaggtcggagctgacggtgtgcagtgtgaagtgggcatcgcccccacattt
ccggcgttgtacgaggtttgcaaggtgatcgagtggagcggaatcaggctctgcgctcag
aactgtcattacgagagtgatggcccattcaccggcgaggtctccacgcggatgcttgcc
gctgccggatgcagctatgttatcctcgggcactcggagcgccgtcaactgttcggcgaa
accaatgccacggtcaacctcaaggtcaaaaaggcgttggctgaagggttgagcgtcatc
ctctgcgttggtgagacgctcgacgagcgcgagcgcggcgtgacgggtcagatcgtcact
gcccaagtggttgaggggctgattgatgttaccgacatcagcaagctggtgattgcctac
gaaccggtatgggcaatcggcaccggcaaaaccgccaccaaagagcaggcgcaggaggtt
cacgcgctgattcgggcgaaagtcaccgaactctacggtcagaaagcggcggaccatctc
aggatccagtacggcggcagcgtcaaaccctctaacgctgcggagcttttcgccatgccg
gatatcgacggtggcctgattggtggcgcgagcctcaatgccgacgacttcatggcgatt
gtcgaggcggcggggtaa

DBGET integrated database retrieval system