KEGG   Chlorobaculum tepidum: CT1772Help
Entry
CT1772            CDS       T00088                                 

Gene name
rbcL
Definition
(RefSeq) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cte  Chlorobaculum tepidum
Pathway
cte00630  Glyoxylate and dicarboxylate metabolism
cte01100  Metabolic pathways
cte01120  Microbial metabolism in diverse environments
cte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CT1772 (rbcL)
Enzymes [BR:cte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CT1772 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 1008092
NCBI-ProteinID: NP_662651
CyanoBase: CT1772
CYORF: CT1772
UniProt: Q8KBL4
Structure
PDB: 

Position
complement(1677980..1679287)
Genome map
AA seq 435 aa AA seqDB search
MNAEDVKGFFASRESLDMEQYLVLDYYLESVGDIETALAHFCSEQSTAQWKRVGVDEDFR
LVHAAKVIDYEVIEELEQLSYPVKHSETGKIHACRVTIAHPHCNFGPKIPNLLTAVCGEG
TYFTPGVPVVKLMDIHFPDTYLADFEGPKFGIEGLRDILNAHGRPIFFGVVKPNIGLSPG
EFAEIAYQSWLGGLDIAKDDEMLADVTWSSIEERAAHLGKARRKAEAETGEPKIYLANIT
DEVDSLMEKHDVAVRNGANALLINALPVGLSAVRMLSNYTQVPLIGHFPFIASFSRMEKY
GIHSKVMTKLQRLAGLDAVIMPGFGDRMMTPEEEVLENVIECTKPMGRIKPCLPVPGGSD
SALTLQTVYEKVGNVDFGFVPGRGVFGHPMGPKAGAKSIRQAWEAIEQGISIETWAETHP
ELQAMVDQSLLKKQD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaagacgtcaaaggtttttttgcttccagggaatcgctcgacatggagcaa
tacctcgttctcgactactacctcgaatctgtcggggatatagagacggcgcttgcccat
ttctgcagcgagcagtcaactgctcagtggaagagggtcggcgtcgatgaggatttccgt
ttggtgcacgccgccaaggtgatcgattacgaggtgatcgaggagcttgagcagctcagc
tatccggtcaagcactccgagaccggcaagattcatgcctgtcgcgtgacgattgctcat
ccgcactgcaatttcgggccgaagattcccaatcttctgaccgccgtttgcggcgagggc
acctacttcacgccgggcgtaccggtggtgaagctgatggacattcactttcccgacacc
tacctcgccgatttcgaggggccgaagttcggcatcgaggggttgcgcgacattctcaac
gctcacgggcgtccgatcttctttggggtcgtcaaaccaaatatcggtctcagtcctggg
gagtttgccgagatcgcctaccagagctggctgggcggactcgatatcgccaaggatgat
gagatgctggccgatgtgacctggtcgagcatcgaagagcgtgcggctcatctcggtaag
gcgcggcgcaaggccgaagccgagaccggtgaacccaagatttacctggccaacatcact
gacgaggtggacagcctgatggagaagcacgatgttgccgtacgcaacggagccaatgcc
ttgctcatcaatgcgcttccggtgggactgagtgccgtccggatgctcagcaactacacg
caggtgccgctgatcggtcattttccgttcattgcctcgttcagccgcatggaaaaatat
ggcattcactccaaggtgatgaccaagttgcagcgccttgccggtctcgacgcggtgatc
atgcccggcttcggcgatcgcatgatgactcccgaggaggaggtgctcgaaaacgtgatc
gagtgcaccaaaccgatgggtcgcatcaagccgtgccttccggtgcccggcggcagcgat
tcagcgctgacgcttcagaccgtgtatgaaaaggtcggcaacgtggactttggctttgta
ccggggcgcggcgtgttcggccatccgatggggccgaaagctggcgccaaaagcatcagg
caggcttgggaggctatcgagcagggtatttcaattgaaacctgggccgagacccatccc
gaactccaggccatggtcgatcaaagcttgctgaagaagcaggactga

DBGET integrated database retrieval system