KEGG   Chlorobaculum tepidum: CT2018Help
Entry
CT2018            CDS       T00088                                 

Definition
(RefSeq) dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cte  Chlorobaculum tepidum
Pathway
cte01100  Metabolic pathways
Brite
Enzymes [BR:cte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     CT2018
Glycosyltransferases [BR:cte01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   CT2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 1007543
NCBI-ProteinID: NP_662893
CyanoBase: CT2018
CYORF: CT2018
UniProt: Q8KAY2
Position
complement(1914042..1914770)
Genome map
AA seq 242 aa AA seqDB search
MLIVKTLVIIPTYNEAENIRPLVEDILDRYPEGLELLVIDDSSPDGTAGIVKAIMKNEPR
VMLLSRPSKLGLGTAYLTGFRYALERGYERVIEMDADFSHDPASIASLIKAMDGADMVIG
SRYMNNTVNVVNWPLSRLILSKSASIYSRWITGMPVSDPTSGFKCISAKALRFIALDRVR
SQGYSFQIEIDFRVWKKNLVIHEVPIIFVDRSVGKSKMTRKNIVEAVWMVWWLKFLSIIG
RL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgtgaaaacactggtcatcataccgacttacaacgaagcggaaaacataagg
cctcttgtcgaggatattctcgatcgttatccggaggggctagagcttctcgttattgat
gacagttctccggatggtacagccggtattgtcaaggcgatcatgaaaaatgagccgcgc
gtcatgcttttgtcaagaccgtcgaaattggggcttggcacggcctatctcacggggttt
cgctatgcactcgaacgtgggtatgagcgcgtcatcgagatggatgccgatttttcgcat
gatccggcctcgattgcatctctgatcaaagccatggatggcgcggatatggttattgga
tcaaggtacatgaacaacacggtcaacgtggtcaactggccgttgtcgcgccttatcctt
tccaagtcagccagtatttacagcagatggatcaccggtatgccggtatccgatccaacc
agcgggttcaaatgcatcagtgccaaggcgctgcgattcatagcgcttgacagggtgcgt
tcacaaggctactcctttcagatcgagatcgattttcgggtatggaaaaaaaacctcgtt
atccatgaggtgccgatcatttttgttgacagaagcgtaggcaaatcgaaaatgaccagg
aaaaatattgttgaggcggtctggatggtctggtggctgaaattcctttcgatcatcggg
cggctttga

DBGET integrated database retrieval system