KEGG   Chlamydia trachomatis E/C599: EC599_1871Help
Entry
EC599_1871        CDS       T03168                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ctec  Chlamydia trachomatis E/C599
Pathway
ctec00030  Pentose phosphate pathway
ctec00480  Glutathione metabolism
ctec01100  Metabolic pathways
ctec01110  Biosynthesis of secondary metabolites
ctec01120  Microbial metabolism in diverse environments
ctec01130  Biosynthesis of antibiotics
ctec01200  Carbon metabolism
Module
ctec_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ctec_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ctec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EC599_1871 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EC599_1871 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctec04147]
    EC599_1871 (zwf)
Enzymes [BR:ctec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EC599_1871 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EC599_1871 (zwf)
Exosome [BR:ctec04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EC599_1871 (zwf)
  Exosomal proteins of colorectal cancer cells
   EC599_1871 (zwf)
  Exosomal proteins of bladder cancer cells
   EC599_1871 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N VWA_3
Motif
Other DBs
NCBI-ProteinID: CDG43076
Position
207297..208820
Genome map
AA seq 507 aa AA seqDB search
MEEIKDFGPTLPACPPCIVVIFGATGDLTSRKLFPALYNLTKEGRLCENFVCVGFARRPK
SHEQFREEMKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSALKAYLEQLDQQ
YGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVNLETAREL
QQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYIDHVQISVSESIGI
GSRGNFFEKSGMLRDMVQNHLTQLLCLLTMEPPSEFSSEEIKKEKIKILKKILPIREEDA
VRGQYGEGIVQDVSVLGYREEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPK
RTTDIAVIFKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVRPV
KMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLLEKWSQVRPIF
PNYMAGSLRPQEADELLSRDGKAWRPY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaattaaagactttggccccacattaccagcctgtcctccctgtatcgtggtc
atttttggtgctacaggagacttgacctctaggaagctctttcctgctttatacaattta
acaaaggaaggacgtctatgcgaaaactttgtttgtgttgggtttgctaggcgacctaag
tctcatgagcaatttcgcgaagaaatgaagcttgccgttcagcatttctctcactcatcg
gaaatagatattcgagtttgggaaagtctggaaaatagaatcttttaccaccaagctaat
ttttctgatgccgaaggctactctgctctgaaagcttatttggagcaactagatcaacaa
tatggaacacaagggaatcgtcttttttatttatcaacaccaccagattatttccaggaa
atcatccgcaatttaaatcggcatcagctattctatcatgaacaaggagcacaacagcct
tggtctcggctaattatagaaaagccttttggagttaatttagaaacagctcgagagctt
caacaatgcattgatgccaatattgatgaagagtcggtttatcgaatagaccattattta
ggaaaagaaacggttcaaaacattctgactattcgttttgctaatactctctttgagtct
tgctggaattctcagtacatagatcatgtgcaaatcagcgttagcgaatcaattggtata
ggatctcgagggaatttcttcgaaaagtcgggcatgctacgagacatggtacagaatcat
ttgacgcagctgctatgtctactgactatggaacctccttctgaattttcttccgaagaa
ataaaaaaagaaaaaattaaaattctaaagaaaattcttcctatccgcgaagaagatgct
gttcgtggccaatatggtgaagggattgtgcaagatgtttcagttctgggctatcgggag
gaagaaaatgtcgatccgaattcttcagtagaaacctacgttgcgttaaaattatttatc
gacaatcctcgctggaaaggggttcccttttacttacaagcagggaaacgtcttcctaaa
agaacaacagatatcgctgtgatctttaaaaaatccagctacaatttattcaatgcagag
aattgtcctttgtgtccgttggaaaatgatttacttattattcgtattcaaccggatgaa
ggtgttgcgctacaatttaactgcaaggttccaggaacaaataaactcgtacgtcctgta
aaaatggacttccgttacgacagctattttaatactgttactcccgaagcttatgaacgg
ttactgtgcgactgtatccttggggacagaacgctattcactagcaatgaagaagtctta
gcatcttgggaactattttctcctctattagaaaaatggtctcaagtacgccctatattc
cctaactatatggctggatctttacgtcctcaagaagctgatgaactattatctagagat
ggaaaagcttggcggccctattaa

DBGET integrated database retrieval system