KEGG   Chlamydia trachomatis E/C599: EC599_5221Help
Entry
EC599_5221        CDS       T03168                                 

Gene name
ruvC
Definition
(GenBank) endodeoxyribonuclease
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ctec  Chlamydia trachomatis E/C599
Pathway
ctec03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EC599_5221 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ctec03400]
    EC599_5221 (ruvC)
Enzymes [BR:ctec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     EC599_5221 (ruvC)
DNA repair and recombination proteins [BR:ctec03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EC599_5221 (ruvC)
    RecFOR pathway proteins
     EC599_5221 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC Pox_A22 DNA_methylase
Motif
Other DBs
NCBI-ProteinID: CDG43402
Position
complement(581432..581944)
Genome map
AA seq 170 aa AA seqDB search
MADLIMGIDPGTLVCGYALIKVENRYHIHPHSFGKVKLSQKLALAHRYKQLFTEISTILQ
QESPKAVVLETQYVHKNPQSTIKLGMARGVLLLAASLQDVPVFEYAPNTAKKAAVGKGNA
SKKQVQLMVSKLLRVPDLLAEDNEDIADAFALAMCHAHLAPYQDLKKTLV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttgatcatggggatagatccaggaacgttagtttgtggatacgcgttgatt
aaggtagaaaatcgatatcacattcacccacatagttttggaaaggttaagctctctcag
aagttagctttggctcatcgttataaacagttgtttacagagatttccacaattcttcaa
caagagtctcctaaagctgttgttttagagacgcagtacgtccataaaaatccccaaagt
accattaagctgggaatggctagaggtgttttattattagcggcatctttacaggatgtc
cctgtatttgaatacgctcccaatacggctaaaaaagctgctgtgggtaaaggcaatgct
tctaagaagcaggtacagttaatggtgagcaaattattgcgtgttccagatcttttagca
gaagataatgaggatatagcggatgcctttgctttagccatgtgccacgcacatctcgct
ccttatcaggatttaaagaagactcttgtataa

DBGET integrated database retrieval system