KEGG   Chlamydia trachomatis E/C599: EC599_5441Help
Entry
EC599_5441        CDS       T03168                                 

Gene name
rplV
Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
ctec  Chlamydia trachomatis E/C599
Pathway
ctec03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctec00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EC599_5441 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctec03011]
    EC599_5441 (rplV)
Ribosome [BR:ctec03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EC599_5441 (rplV)
  Bacteria
    EC599_5441 (rplV)
  Archaea
    EC599_5441 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Bac_DNA_binding
Motif
Other DBs
NCBI-ProteinID: CDG43423
Position
complement(593835..594170)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAIANAESN
ENIKCENLCVLEVRVDAGPMFKRMKSKSRGGRAPILKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaggctcgtttagctgca
ggattgatgagaaaccgtagtgttgttgaagctcaacagcaactcagcttttctcagatg
aaggctggaagatgccttaaaaaagtgttggatagcgctattgcaaatgcagagtccaat
gaaaatataaaatgtgaaaatctttgcgttctagaagttcgggttgatgccggcccaatg
ttcaaaagaatgaagtctaagagtcgtgggggaagagccccgattttgaagcgcacgagt
catctaactgtgattgttggcgagagagggcagtag

DBGET integrated database retrieval system