KEGG   Chlamydia trachomatis E/C599: EC599_7811Help
Entry
EC599_7811        CDS       T03168                                 

Gene name
hemN_1
Definition
(GenBank) coproporphyrinogen oxidase (NAD)
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ctec  Chlamydia trachomatis E/C599
Pathway
ctec00860  Porphyrin and chlorophyll metabolism
ctec01100  Metabolic pathways
ctec01110  Biosynthesis of secondary metabolites
Module
ctec_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ctec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EC599_7811 (hemN_1)
Enzymes [BR:ctec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     EC599_7811 (hemN_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: CDG43648
Position
complement(868101..869474)
Genome map
AA seq 457 aa AA seqDB search
MFNINFNFLKGLHQPAPRYTSYPTIVDWESSSDYGYTALERLAQEQDPLSLYFHIPFCQS
MCLYCGCTVVLNRKAEIVDHYIETLIQEMRLAFSLLGGKKPVSRIHFGGGTPSRLSRAQF
ERLFTHIHRFFDLSNIEELAIEFDPRSLREDADKPLFLHNLGFNRVSLGIQDTQWEVQEA
VRRRQSYEESLLAYQLFRDLKFTGINIDLIYGLPKQTQSSFKQTIEHILDMRPDRLALFS
FAHVPWAKPHQKALRTKDLPSMEEKFAIYSQSRHTLIQEGYQAIGLDHFSLPDDPLTIAL
KNKTLIRNFQGYSLPPEEDLLGFGISATSFIRGIYLQNVKDLREYSETIQAGKLATVKGK
ILSQDDKIRKWVIHTLMCSFSLSKLEFEQRFHERFDRYFADSYDRLCGMESAGLIRQDSS
SLQVTPLGELFVRVIATAFDHYFLKNIVEKPLFSKSI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacatcaatttcaacttcctaaaagggctgcatcaaccagctcctcgctatacg
agctaccccaccatcgtcgactgggaatcctcctcagattatggctatacggccttggag
aggcttgctcaggagcaagatcctctttctttatacttccacatcccattctgccaatct
atgtgtctatattgcggatgtactgttgttttaaatagaaaagcagaaatcgtagatcac
tacatagagacgttaatccaagaaatgcgcctagctttctcgttattaggagggaagaaa
ccagtctctagaattcactttggtggcgggactcctagtcgtttatcgcgtgctcaattt
gaacgtttgttcactcatatccatcgtttttttgatttatccaatatcgaagaacttgcc
atagagttcgatcctcgaagtctcagagaggatgccgataaacctctattccttcataac
ctaggttttaatcgtgtgagtctgggtattcaggatacccaatgggaagttcaagaagct
gttcgtagacgccaatcttacgaagaatcgctcttagcttatcaactattccgagactta
aaattcacaggtattaatattgacctcatttatggtctccctaaacaaacacagtctagt
tttaaacaaaccattgaacatatcttagatatgcggccagaccgcctagcccttttctcc
ttcgctcatgtaccttgggctaagccgcatcaaaaggctttgcgcactaaagatctccct
tccatggaagagaaattcgcgatttattcccaatctcggcataccctgatccaggaaggc
taccaggctattggtctagatcatttttctcttccggatgatcctctaactatcgccctt
aagaacaaaacgttgattcgtaatttccaaggatactctcttcctcctgaagaagatctt
ctaggttttggtatatcggcaaccagtttcattcgggggatctatttacaaaatgttaag
gatcttcgtgaatattctgagactattcaggctggcaaactagcaactgtgaaaggcaag
attctttctcaggatgataaaatccgcaaatgggtgattcataccctaatgtgttctttt
tcattgtctaaactggagttcgaacaacggtttcatgaacgctttgatcgatactttgca
gatagctatgatcggctgtgcgggatggagagtgcaggattaattcggcaagactcctct
tctttacaagtaactcctcttggagagctttttgtacgggtcattgccacagcctttgac
cattattttttgaagaacatcgtagaaaaacctcttttttcgaagtctatatga

DBGET integrated database retrieval system