KEGG   Chlamydia trachomatis E/C599: EC599_8481Help
Entry
EC599_8481        CDS       T03168                                 

Gene name
ptr
Definition
(GenBank) exported insulinase/protease (pseudogene)
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ctec  Chlamydia trachomatis E/C599
Brite
KEGG Orthology (KO) [BR:ctec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ctec01002]
    EC599_8481 (ptr)
Enzymes [BR:ctec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     EC599_8481 (ptr)
Peptidases and inhibitors [BR:ctec01002]
 Metallo peptidases
  Family M16: pitrilysin family
   EC599_8481 (ptr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-ProteinID: CDG43709
Position
complement(join(943254..946109,946109..946123))
Genome map
AA seq 956 aa AA seqDB search
MDNTFPVINDPTNDPKNMKRSLSLLLLCIPSFLTACSKSFQTIRDENPLTILTPALADQK
IAKILCPNGLSLMIVSSPHAAESGAALVVKTGNNADPVEFPGLAHFTEHCVFLGNEKYPE
PSGFPAFLSTHGGIYNAFTYPDKTCFLFSVNNADLDNALDQFVHLFIQPLFRQEDLNKEV
HAVEQEFAMHPTKDSRRMHRIQQLIAPKNHPLKRFGCGNLSTLNSVTTQDMQTWFATHYS
PENMAAIVYTTAPLDTAVPYIASLFSEIPISAQYTPQKPFPKTQDTTALNKLFINKAVEP
SPQLAIYWHFYDAPQSLQGWAQSLISILSSEKENSLVALLKKEQLITEMEAELYSTSHNT
QDFEILYKLTNKGEREYQRVLQLTFAFLDYVRHERLPAYSLPEIQKINSLEYTYSTQTEL
FSTLSRMVPNFTSEPLATYPYRSLVYPEYSQEDEQTFATFLADPQQARYILSATLPSSWE
NADEFYDPIFDDTFYEKPLDFTPIQDSSSSGFAFPNPNKFIPQTVQLLSQKKQHEGFAFS
PQLTYDQNAITLYTCEDSFYTIPKMAMELRIRSPQIQRTDVRSLVLRDLYSLLANETLIK
RYDDALKAGMTFAVSPGATGVDLSLLGYTETSPVLINALLSSLRDLPVEESLFLYYKDQL
SEQYQKNLIACPIRAGLNKLYSQILVDTVSLEDKLNTLNTLSYEEFANFTNKLLQELAVE
SLALGTLSAQDLSNLLSTLSNFAEASSPYAAPSYYPQRKPLSSTKLSFQYPLSGNGMLLL
EQNEDPHQYKDSVATSMLLSWIHNLYFSDLRTEQQLGYMVGSKYLEFAETPCGLFYIRSN
NYSPEELVHRTQLFIQKIATDPESAGLSEEIFEQLRETYIQSILLPSSTPLAMAKKLFSI
AFETKKQDFSRPDQKIAAARSMDYSYFKKYCEEFLSQKFGPEIQLLVYGANSSQEK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaccttccctgttatcaatgaccctaccaatgaccccaaaaatatgaagcgt
tccctatccctattacttctttgcattccttcttttctaactgcttgctcgaaatccttt
caaacgattcgagatgaaaaccctttgactattttgacccctgcattagcagatcaaaaa
attgctaaaattctatgccctaacggactctctctcatgattgtatcctcccctcatgct
gctgagtccggagccgctttagttgtcaaaacaggaaataatgcagatcctgtcgagttc
ccaggcttagcccattttacagaacactgtgtgttcctcgggaatgaaaaatatcccgag
ccctcaggatttcctgccttcctaagcacacatgggggtatctataacgcatttacttac
ccagataaaacctgcttcctattctccgtaaacaatgcagatttagataatgctctggat
cagtttgtacatctctttatccaacctctcttccgccaagaagatttaaacaaagaagtt
catgctgttgagcaagaatttgcgatgcatccaactaaagattctcgtcgtatgcatcgt
attcaacaacttatagctcctaaaaatcacccattaaaacgctttggctgcggcaatctc
tctaccctcaactccgtcactactcaagatatgcaaacatggtttgccactcactactct
ccagaaaatatggcagcaattgtttacactacagctccgttggacaccgcagtgccgtat
atcgcgtccctattctctgaaatccctatatctgcacagtacacaccacaaaaaccgttt
ccaaagacacaggatactactgctcttaataaactgttcatcaataaggctgtcgaacct
tctccacaactagctatttactggcatttttatgatgctccacagtccttacaaggatgg
gctcagtcactgatttctattttatctagtgaaaaagaaaatagtcttgttgctttactc
aaaaaggaacagctcattactgagatggaagcagaactttacagcacttctcataataca
caagattttgaaattctttataaactcaccaataagggggaacgcgaatatcaaagagtt
ttgcagctaacttttgcttttcttgattatgttcgtcatgaacgacttcctgcctactcc
ttgccagagatacagaaaatcaactctttagaatatacttacagcacgcaaaccgagtta
ttctcgacactatcacgaatggttcccaattttacttctgaaccattagcaacataccct
tatcgctctcttgtctatccagaatactcccaagaagatgaacaaacctttgctacattt
ttagcagaccctcaacaggcacgttatatcttatctgctaccctaccgagttcttgggag
aatgcagatgaattctatgatcccatctttgacgacactttctatgaaaaacccttagat
ttcacacctatacaggactcctcctcctcaggatttgcttttccgaatcccaataaattt
attcctcaaacagtccaattattatctcaaaagaaacaacacgaagggtttgctttttct
ccgcagctgacctatgatcaaaatgcgatcactttatatacttgtgaagactctttctat
acgattcctaaaatggctatggagttgcgcatccgttctcctcaaattcaacgaacagat
gtgcgttctttagtattacgagacctatatagtctactagctaatgaaacattaataaaa
cgttatgacgatgctttaaaagctggaatgacttttgcagtatctcctggagcgacaggg
gttgatctttctcttttaggatatactgagacctctcctgttcttatcaatgctttgctg
tcttctttacgagatcttcctgtggaagaaagtctgtttctatattacaaagatcagcta
tcagaacaatatcagaagaatcttattgcctgccctataagagctggtctcaataaacta
tactctcagattcttgttgataccgtttccttagaagataagctcaatactttaaacacc
ctctcctacgaagagtttgcgaacttcacgaataaactactccaagaactagctgtagaa
tctttagcactaggaacgctctcggctcaagatctctccaatttattatcgactctctct
aactttgcagaagcttcgtctccttatgctgctcctagctattatcctcaaagaaaacct
ctctcttctacaaagctttcgttccaatatcctctctctggaaatggtatgctgctgctc
gaacaaaacgaagatccccatcaatataaggactctgtagctactagtatgttgttatct
tggatccataacttgtacttctctgatttacgtacagagcaacaacttgggtatatggta
ggttctaaatatctggaattcgcagaaactccttgtggacttttctatattcgatccaat
aactattctcctgaggagcttgtgcatagaacacaactctttatacaaaagattgctact
gatccagaatctgcaggcttgtccgaagagatctttgaacagcttcgagaaacatatatc
cagtccatattgcttccaagttccacacctttagctatggcgaaaaaattattctctata
gcttttgaaacgaaaaaacaggatttttctcgcccagaccaaaaaatagctgctgcccgt
tctatggattacagctatttcaaaaagtactgtgaagaatttttgagtcaaaagtttggc
ccagaaatccaactcctcgtctatggagccaactcgtcgcaggaaaaataa

DBGET integrated database retrieval system