KEGG   Corynebacterium testudinoris: CTEST_00260Help
Entry
CTEST_00260       CDS       T03956                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00071  Fatty acid degradation
cted00072  Synthesis and degradation of ketone bodies
cted00280  Valine, leucine and isoleucine degradation
cted00310  Lysine degradation
cted00362  Benzoate degradation
cted00380  Tryptophan metabolism
cted00620  Pyruvate metabolism
cted00630  Glyoxylate and dicarboxylate metabolism
cted00640  Propanoate metabolism
cted00650  Butanoate metabolism
cted00900  Terpenoid backbone biosynthesis
cted01100  Metabolic pathways
cted01110  Biosynthesis of secondary metabolites
cted01120  Microbial metabolism in diverse environments
cted01130  Biosynthesis of antibiotics
cted01200  Carbon metabolism
cted01212  Fatty acid metabolism
cted02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cted00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTEST_00260
   00630 Glyoxylate and dicarboxylate metabolism
    CTEST_00260
   00640 Propanoate metabolism
    CTEST_00260
   00650 Butanoate metabolism
    CTEST_00260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CTEST_00260
   00072 Synthesis and degradation of ketone bodies
    CTEST_00260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTEST_00260
   00310 Lysine degradation
    CTEST_00260
   00380 Tryptophan metabolism
    CTEST_00260
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTEST_00260
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTEST_00260
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTEST_00260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cted04147]
    CTEST_00260
Enzymes [BR:cted01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CTEST_00260
Exosome [BR:cted04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTEST_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKK07522
UniProt: A0A0G3H8M6
Position
51196..52353
Genome map
AA seq 385 aa AA seqDB search
MRDVYVAGIGETPMGRYPDRSLHDMIRDAAGQAIAESGIDPARIGAAYIGNFAGQTLTGQ
GHLGPLMTETLGLIDVPAFRIEGACASGGLALHQAVQAIRYGIHDVVLVGGMEKMTHQST
AVVTEALTSAMDITYEGHSGLTFPGLFAMVANRYFHEHRNVRREMAQVAVQSHDNALLNP
HAQLRKQIDVDKVLSAPAIADPLGLYDCSLVTDGAAFLVLTADPVAEVGKRGVRITGVGH
GGDALTLHGKATKTSFKATRQASATAYEQAGLTPADIDLAEVHDCFTITQIINTEDLGFF
EPGRGGDAVAEGRTARNGDIPINTSGGLKAKGHPVGATGISQAIEIITQLRGDAAERQVT
TPTIGLTHNLGGTAGTCVVTIFEGE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgtctacgtcgccggcatcggcgaaacacccatgggccgctacccagaccgc
agcctccacgacatgatccgcgacgccgctggccaggccatcgccgaatccggcatcgac
cctgcccgcatcggcgccgcctacatcggcaacttcgccggccaaaccctcaccggccag
ggccacctcggcccccttatgaccgaaacccttgggcttatcgacgtccccgccttccgc
atcgaaggcgcctgcgcctccggtggcctcgccctccaccaagccgtccaggccatccgc
tacggaatccacgacgtggtgctcgtcggcggcatggagaagatgacccatcaatccacc
gccgtggtcaccgaagcactcacctccgcaatggacatcacctacgagggacactccgga
ctcaccttccccggcctcttcgccatggtggccaaccgctacttccacgaacaccgcaac
gtccgccgcgagatggcccaggtcgccgtacaatcccacgacaacgccctgctcaacccg
catgcgcaactgcgcaagcagatcgacgtcgataaggtgctgtccgcgcccgccatcgcc
gaccccctcggactctacgactgctctctggtcaccgacggcgctgccttccttgttctc
accgccgatcccgtggcggaggtgggcaaacgaggagtacgcatcaccggcgtcggccac
ggcggcgacgcactcaccctccatggcaaagcaacgaagaccagcttcaaggccacccgc
caagcctccgccaccgcctacgaacaggcaggcctcacccccgccgacatcgacctcgcc
gaagtccacgactgcttcaccatcacccagatcatcaacaccgaggacctcggcttcttc
gaacccggccgcggcggcgacgccgtcgccgagggccgcaccgcccgcaacggcgacatc
cccatcaacacctccggcggcctcaaagccaaaggccatcccgtcggcgcaaccggcatc
agccaagccatcgaaatcatcactcaactgcgtggcgacgccgccgaacgccaagtcacc
acccccaccatcggtctcacccacaacctgggcggcaccgccggcacctgcgtggtcacc
atcttcgagggagagtaa

DBGET integrated database retrieval system