KEGG   Corynebacterium testudinoris: CTEST_00955Help
Entry
CTEST_00955       CDS       T03956                                 

Gene name
gluQ
Definition
(GenBank) tRNA synthetases class I (E and Q), catalytic domain
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00860  Porphyrin and chlorophyll metabolism
cted00970  Aminoacyl-tRNA biosynthesis
cted01100  Metabolic pathways
cted01110  Biosynthesis of secondary metabolites
cted01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cted00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTEST_00955 (gluQ)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTEST_00955 (gluQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cted01007]
    CTEST_00955 (gluQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cted03016]
    CTEST_00955 (gluQ)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cted02048]
    CTEST_00955 (gluQ)
Enzymes [BR:cted01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CTEST_00955 (gluQ)
Amino acid related enzymes [BR:cted01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CTEST_00955 (gluQ)
Transfer RNA biogenesis [BR:cted03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CTEST_00955 (gluQ)
 Prokaryotic Type
   Other AARSs
    CTEST_00955 (gluQ)
Prokaryotic defense system [BR:cted02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CTEST_00955 (gluQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AKK07656
UniProt: A0A0G3H2Q4
Position
191306..192202
Genome map
AA seq 298 aa AA seqDB search
MTGAGRYAPSPSGDLHFGNLRTALIAWLFARHSGRSFLLRVEDIDTGRSSLESAHRQIED
LLTLGLTFDGDILYQSSRSEAYAAALEQLPVYECYCSRKDIQEASRAPHAIPGSYPGTCR
LLSDAARAQRRADLAAQGRVPALRLRAETTSFTIHDFYRGAYTGDVDDFVLRRGGQEPGW
AYNLAVVVDDGFQGVDQVVRGDDLLSSAPRQAYLASLLGLPVPAYSHVPLVLGPTGKRLA
KRDGAVTLREMLVDHSVPDVVGRLATTLGYPGVDELSQLLEVFDPEELPRDEIIWHGN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactggcgccggacgatacgcaccctccccgagcggggatctccactttgggaacctg
cgcaccgctctcatcgcgtggctgttcgcgcgccattccgggcggtcgttcctcctgcgc
gttgaggatatcgacaccggccgttcctccctcgaatccgcccaccgccagatcgaggac
ctgctcaccctcggcctcaccttcgacggcgacattctctatcagtcctcgcgctccgag
gcttacgccgccgccctcgagcagttgcccgtctatgagtgttactgctcgcgcaaagac
atccaggaggcctcccgggcgccgcacgccattccgggtagctatcccggtacctgccga
ttgctttccgacgccgcccgtgcccaacgccgcgccgacctcgccgcgcagggccgcgtc
ccggccctgcgcttgcgcgcagagaccacttccttcaccatccatgatttctaccgtggg
gcctacaccggcgacgtcgatgattttgttctgcgccgcggcggccaggaacccgggtgg
gcatacaacctggccgtcgtcgtcgacgatggtttccagggcgtcgatcaggtcgtgcgc
ggcgacgacctcctgtccagcgccccccgccaggcttacctcgccagcctccttggcctc
ccggtgccggcgtactcccatgtcccgctggtgcttgggcccacggggaagcgcctggcc
aagcgtgacggagcggtgacgctccgggaaatgctcgttgaccactctgtgcccgatgtt
gtcggccgcttggcgacgaccctggggtacccgggcgtcgacgagctttcacaacttctc
gaggtttttgatcccgaggaactccccagagacgaaattatttggcacggcaattaa

DBGET integrated database retrieval system