KEGG   Corynebacterium testudinoris: CTEST_03870Help
Entry
CTEST_03870       CDS       T03956                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00450  Selenocompound metabolism
cted00970  Aminoacyl-tRNA biosynthesis
cted01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cted00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CTEST_03870 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTEST_03870 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cted01007]
    CTEST_03870 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cted03016]
    CTEST_03870 (metG)
Enzymes [BR:cted01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CTEST_03870 (metG)
Amino acid related enzymes [BR:cted01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CTEST_03870 (metG)
Transfer RNA biogenesis [BR:cted03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CTEST_03870 (metG)
 Prokaryotic type
   Other AARSs
    CTEST_03870 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AKK08223
UniProt: A0A0G3H8R3
Position
776304..778142
Genome map
AA seq 612 aa AA seqDB search
MTQSVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMVGNEVLMISGTDEHGTPLLVQ
ADKEGVTVKELADRYNRQIVEDLAGLGLTYDLFTRTTTRNHYAVVQELFKGLYDNGYMIK
ETTQGAVSPSTGRTLPDRYIEGTCPICNYPEARGDQCDNCGNQLDPSDLINPVSKINGET
PEFVETEHFLLDLPSLADALGEWLRGREDWRPNVLKFSLNLLDDLRPRAMTRDIDWGVPI
PVEGWQDNNAKKLYVWFDAVVGYLSASIEWAWRSGQPDAWKQWWQNPEATGYYFMGKDNI
TFHSQIWPAELLGYAGKGSKGGTLHEYGEINLPTEVVSSEYLTMSGSKFSSSKGVVIYVK
DFLAEFGPDPLRYFIAVAGPENTDTDFTWDEFVRRVNNELANGWGNLVNRTVAMANKNFG
EVPAPGALTESDQKILDLAASTFDVVGEALAASKFKAGITAAMHVVGEANAYIAEQEPWK
LAKDETQRERLATVLWTALQVVSDCNVLLTPYLPHIAQQVHETLGRDGVWAATPVIEEVT
DDMPVELVGVDLPEAGQTYPVITGDYTSQQAVWKRIDVVAGTPLDKPQPLIQKLDPELAE
TGPEWAPILSES
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtctgtgcttgtctccgtcgcctggccgtatgccaacggcccccgccacatc
ggacacgtcgccggtttcggcgtcccctctgatgtctttgcccgctaccagcggatggtg
ggcaacgaggtcctcatgatctccggcacggacgagcacggcacccccttgttggtgcag
gccgacaaggaaggcgtgaccgtcaaggaactcgccgatcgctacaaccgccagatcgtc
gaagacttggccggtctgggcctgacctacgacctgtttacccgcaccaccacccggaac
cactacgcggtggtgcaggagttgttcaagggcctctacgacaacggttacatgatcaag
gagacgacccagggcgcggtatccccgtcgaccgggcgcaccctgcccgaccgctacatc
gagggcacgtgcccgatctgcaactaccccgaagcccgcggcgatcagtgtgacaactgc
ggcaaccagctcgacccctccgacctgatcaacccggtgtccaagatcaacggggagacc
ccggagttcgtcgaaaccgagcacttcctcctcgacctgccctccctcgccgacgcgctg
ggcgagtggctgcgcgggcgcgaagactggcgccccaacgtgctgaagttctccctcaac
ctcctcgacgacctgcgcccccgcgccatgacccgcgacattgactggggtgtgcccatc
ccagtggagggctggcaggacaacaacgccaagaagctctacgtgtggttcgacgctgtc
gtgggctacctctccgcctccatcgagtgggcgtggcgttccggccagcccgacgcttgg
aagcagtggtggcaaaaccccgaggccaccggctactacttcatgggcaaggacaacatc
accttccactcccagatctggcccgccgagctgctcggttacgccggcaagggatccaag
ggtggcaccctccacgagtacggcgagatcaacctccccaccgaggtcgtctcctccgag
tacctcaccatgtccggctcgaagttctcctcgtccaaaggcgtggtcatctacgtcaag
gacttcctcgctgagttcggtcccgacccgttgcgctatttcatcgccgtcgcaggcccg
gagaacaccgacaccgatttcacctgggatgagttcgtccgccgcgtgaacaacgagctg
gccaatggctggggcaacctggtcaaccgcaccgtcgccatggcgaataagaacttcggc
gaggtgcccgcccccggggctttgaccgaatcagaccagaagatcctcgacctggcggcc
tcgacgttcgacgtcgtcggcgaggctttggccgcctccaagttcaaggcaggcatcacc
gccgccatgcacgtcgtcggcgaagccaacgcctacatcgcggaacaggagccctggaag
ctggccaaggacgagacccagcgcgagcgcctggccaccgtgctgtggaccgctctgcag
gttgtttccgactgcaacgtcctgctcaccccctacctgccgcacatcgcgcagcaggtc
cacgagaccctcggccgcgacggcgtgtgggcagccaccccggttatcgaggaagtcacc
gatgacatgccggttgagctcgtcggcgtcgacttgcccgaagcaggccagacctacccc
gtcatcaccggcgactacacctcgcagcaggccgtgtggaagcggatcgatgtcgtcgcg
ggcaccccgctggacaagccccagcccctcatccaaaaactggaccccgagctcgccgag
accggcccggaatgggcaccgatcctcagcgaaagctag

DBGET integrated database retrieval system