KEGG   Corynebacterium testudinoris: CTEST_09995Help
Entry
CTEST_09995       CDS       T03956                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00071  Fatty acid degradation
cted00072  Synthesis and degradation of ketone bodies
cted00280  Valine, leucine and isoleucine degradation
cted00310  Lysine degradation
cted00362  Benzoate degradation
cted00380  Tryptophan metabolism
cted00620  Pyruvate metabolism
cted00630  Glyoxylate and dicarboxylate metabolism
cted00640  Propanoate metabolism
cted00650  Butanoate metabolism
cted00900  Terpenoid backbone biosynthesis
cted01100  Metabolic pathways
cted01110  Biosynthesis of secondary metabolites
cted01120  Microbial metabolism in diverse environments
cted01130  Biosynthesis of antibiotics
cted01200  Carbon metabolism
cted01212  Fatty acid metabolism
cted02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cted00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTEST_09995 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    CTEST_09995 (phbA)
   00640 Propanoate metabolism
    CTEST_09995 (phbA)
   00650 Butanoate metabolism
    CTEST_09995 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CTEST_09995 (phbA)
   00072 Synthesis and degradation of ketone bodies
    CTEST_09995 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTEST_09995 (phbA)
   00310 Lysine degradation
    CTEST_09995 (phbA)
   00380 Tryptophan metabolism
    CTEST_09995 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTEST_09995 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTEST_09995 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTEST_09995 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cted04147]
    CTEST_09995 (phbA)
Enzymes [BR:cted01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CTEST_09995 (phbA)
Exosome [BR:cted04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTEST_09995 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKK09424
UniProt: A0A0G3H7U7
Position
2066278..2067507
Genome map
AA seq 409 aa AA seqDB search
MSPTSPSDIVLCSPLRTPVGGYGGAFSTIPVQDLAAIVVKAVVERTGLDPAEIDDLILGQ
ASPAGSAPALGRVVALDAGLGDSVPGMQLDRRCGSGLQAVATAAAHIASGAADLIIAGGA
ESMSRAEYSVTPDIRWGVRGGDLVLRDRLAEGRESAGGKHHPIPGGMIETAENLRRAFRI
SREAQDEMAVASHARAVAAQEGMLFDAEIVPVAVPQRKGEPVVISTDEHPRPDTSLEKLA
KLRPVLGHSDEDATVTAGNASGQNDGAAAMIVTTRAKAAELGLVPMLVLRGWAVAGVAPE
TMGIGPVPATAKVLSRLGLTLEDMDLIELNEAFAAQALSVLTEWGISADDPRLNPLGSGI
SLGHPVGATGARMLVTMAHAMSHNPDAQTGLVTMCIGGGQGLAAVVEKP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccccacctccccctccgatatcgtcctctgctccccgctgcgcacgcccgtcggc
ggctacggcggagccttctccaccatccccgtccaagacttagccgccatcgtggtgaaa
gctgtcgtcgagcgcaccggcctcgaccccgccgagatcgatgacctcatccttggtcag
gcctcccccgcgggttccgcccccgccttaggccgggtcgtcgccctcgacgccgggctg
ggcgattccgtccccggcatgcagcttgaccgccgctgcggttccggcctccaggccgtc
gctaccgccgcggcccacatcgcctcgggcgccgctgacctcatcatcgccggtggcgcc
gaatccatgtcgcgcgccgaatactccgtcactcccgacatccgctggggcgtgcgcggc
ggcgacttggtcctgcgcgatcgtctcgccgagggccgcgaatccgccggtggcaagcac
caccccatccccggcggcatgatcgagaccgccgagaaccttcgccgcgcctttcgtatc
agccgggaagcccaggacgagatggcggtggcctcccatgcccgcgccgttgctgcccag
gagggcatgcttttcgacgccgagatcgtccccgtcgccgtcccccaacgcaagggggag
cccgtggtgataagcacagacgagcacccccgccctgacacctccctggagaagttggcg
aagctgcgcccggttcttggtcactccgacgaggatgccactgtcaccgctggcaacgcc
tccggccaaaacgacggggccgcagccatgatcgtgaccacccgcgccaaggctgccgag
ctgggcttagtacccatgctcgtcctccgcggctgggccgtggctggtgtcgccccggaa
accatgggcatcggcccggtccccgccaccgccaaagtgctctcccgcctcggcctcacg
cttgaggatatggacctcatcgaactcaacgaggccttcgccgcccaggccctatccgtg
ctcaccgaatggggcatctcggccgacgatccccggctcaacccgctcggttccggcatc
tccctcggccacccggtcggcgccaccggtgcccgcatgctggttaccatggcccacgca
atgtcccacaaccccgacgcccagaccggcctggtcaccatgtgtattggtggcggccag
ggactggccgcggtcgtcgaaaagccctaa

DBGET integrated database retrieval system