KEGG   Yamadazyma tenuis: CANTEDRAFT_100511Help
Entry
CANTEDRAFT_100511 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cten  Yamadazyma tenuis
Pathway
cten03040  Spliceosome
cten04141  Protein processing in endoplasmic reticulum
cten04144  Endocytosis
cten04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cten00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CANTEDRAFT_100511
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CANTEDRAFT_100511
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CANTEDRAFT_100511
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CANTEDRAFT_100511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cten01009]
    CANTEDRAFT_100511
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cten03041]
    CANTEDRAFT_100511
   03009 Ribosome biogenesis [BR:cten03009]
    CANTEDRAFT_100511
   03110 Chaperones and folding catalysts [BR:cten03110]
    CANTEDRAFT_100511
   04131 Membrane trafficking [BR:cten04131]
    CANTEDRAFT_100511
   03051 Proteasome [BR:cten03051]
    CANTEDRAFT_100511
   03029 Mitochondrial biogenesis [BR:cten03029]
    CANTEDRAFT_100511
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cten04147]
    CANTEDRAFT_100511
Protein phosphatases and associated proteins [BR:cten01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CANTEDRAFT_100511
Spliceosome [BR:cten03041]
 Complex B
  Other components
   Prp19 complex
    CANTEDRAFT_100511
 Complex C
   Prp19-CDC5 complex
    CANTEDRAFT_100511
Ribosome biogenesis [BR:cten03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CANTEDRAFT_100511
Chaperones and folding catalysts [BR:cten03110]
 Heat shock proteins
  HSP70 / DNAK
   CANTEDRAFT_100511
Membrane trafficking [BR:cten04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CANTEDRAFT_100511
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CANTEDRAFT_100511
Proteasome [BR:cten03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CANTEDRAFT_100511
Mitochondrial biogenesis [BR:cten03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CANTEDRAFT_100511
Exosome [BR:cten04147]
 Exosomal proteins
  Proteins found in most exosomes
   CANTEDRAFT_100511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C ATP-synt_DE
Motif
Other DBs
NCBI-GeneID: 18245385
NCBI-ProteinID: XP_006683585
JGI: Cante1_100511
UniProt: G3AXA7
Position
Unknown
AA seq 613 aa AA seqDB search
MADGVFQGAIGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFVAFTEEERLIGDAAKNQ
AALNPKNTVFDAKRLIGRGFEDESVQKDIKSWPFTVLSDNGNPVIEVDYLGEKKTFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLKIEGGVFTVKATAGDTHLGGQDFDTNL
LDFFKKDFQKKTGLDISGDSRALRRLRTACERAKRTLSSVTQTTVEVDSLFDGEDFSANI
TRARFEDINSALFKSTLDPVEQVMKDAKIAKSAVDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLDVIPLSLGVAMQGNVFAPVVPR
NSTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCTENTLLGEFDLKNIPPMSAGEPVLEA
IFEVDANGILKVTAVEKSTGRSANITISNSIGRLSSDEIEKMIEDAEKFKSSDDAFAKRH
EQKQKLEAYVASVETTITDPVLSAKLKKSAKDKIETALSEALAALEIEDSSADDYRKAEL
SLKRAVTKGMSTR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtgttttccaaggtgctattggtatcgatttaggtaccacttactcctgt
gttgctacttatgattctgctgttgaaatcattgccaatgagcaaggtaacagagttact
ccttccttcgttgctttcaccgaagaagaaagattgatcggtgatgccgccaaaaatcaa
gctgccttgaacccaaagaacaccgtttttgacgctaagcgtttgatcggtagaggtttc
gaagatgaatccgtccaaaaagatatcaagtcttggcctttcactgtcttgagcgacaac
ggtaacccagttatcgaagttgactacttgggtgaaaagaagactttctctcctcaagaa
atctcctccatggtcttgaccaagatgaaggaaattgctgaagctaagattggtaagaag
gttgaaaaggctgttgttaccgttccagcttactttaacgatgctcaaagacaagccact
aaggatgctggtgccattgccggtttgaacgtcttgagaattatcaacgaaccaactgct
gctgccattgcttacggtttaggtgctggtaagtccgaaaaggaaagacatgtgttgatt
ttcgatttgggtggtggtactttcgatgtctctttgttgaagatcgaaggtggtgttttc
accgttaaggctactgctggtgacactcacttgggtggtcaagattttgacaccaacttg
ttggacttcttcaagaaggacttccaaaagaagactggtttggacatctccggtgactcc
agagctttgagaagattgagaactgcttgtgaaagagctaagagaaccttgtcttctgtc
actcaaaccactgttgaagtcgactctttgttcgacggtgaagatttctccgctaacatc
accagagctagattcgaagacatcaactctgctttgttcaagtccactttggacccagtt
gaacaagttatgaaggatgctaagattgctaagtccgctgtcgatgaagttgtcttggtt
ggtggttccaccagaattccaaaggtccaaaagttgttgtctgacttctttgatggtaag
caattggaaaagtctattaacccagatgaagctgttgcttacggtgccgctgttcaaggt
gctatcttgactggtcaatccacttctgaagataccaaggacttgttgttgttggatgtt
atcccattgtctttgggtgttgccatgcaaggtaacgttttcgctccagttgtcccaaga
aattcgactgttccaactatcaagagaagaactttcaccactgttgccgaccaccaaacc
actgttcaattcccagtgtaccaaggtgaaagagtcaactgtaccgaaaacactttgttg
ggtgaattcgacttgaagaacatcccaccaatgtctgctggtgaaccagtgttggaagcc
atcttcgaagttgatgccaacggtatcttgaaggttaccgctgttgaaaagtccaccggt
agatccgctaacatcaccatctctaactccatcggtagattgtcttctgatgaaatcgaa
aagatgattgaagatgctgaaaaattcaagtcttctgacgatgctttcgccaagagacac
gaacaaaagcaaaagttggaagcttatgttgcttctgttgaaaccaccatcaccgatcca
gttttgtctgctaagttgaagaagtctgctaaggacaagatcgaaaccgctttgtctgaa
gctttggctgctttggaaatcgaagactcctccgctgacgactacagaaaggctgaattg
tcgttgaagagagccgtcaccaagggtatgtccactcgttaa

DBGET integrated database retrieval system