KEGG   Yamadazyma tenuis: CANTEDRAFT_110982Help
Entry
CANTEDRAFT_110982 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
cten  Yamadazyma tenuis
Pathway
cten00190  Oxidative phosphorylation
cten01100  Metabolic pathways
Module
cten_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CANTEDRAFT_110982
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     CANTEDRAFT_110982
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CANTEDRAFT_110982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 18246238
NCBI-ProteinID: XP_006689315
JGI: Cante1_110982
UniProt: G3BBW9
Position
Unknown
AA seq 277 aa AA seqDB search
MLRSSVRINSIGLLGKRLLQQSSVRYNSSYELPDLSKLPRRKPTEVHVPLVNPADQYKET
SEELHKFGRYIMSCMPKYIQQFSVWKDELTVYVAPSALRPTMIFLKNHTSAQFKSVMDVT
AADYPSRSNRFDVVYNMLSVRYNSRIRVKTYANEISPVPSIVPLFQGANWYERETYDLFG
IFFEGHPDLRRIMTDYGFEGHPLRKDFPTTGYTEVRYDEEKKRVVYEPLELTQASRSFTV
PHSAWEQVGDGKDFTPESFKLPTPEPEPEAEEKGDKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatccagtgtcagaatcaatagcataggcctcctaggcaagcggttgttacaa
cagtcatctgttcgctacaacagctcgtacgagttgccagacttgtcgaagctccccaga
agaaaacccaccgaagtccatgtgcctttagtcaatcctgctgaccagtacaaggaaaca
tccgaagaattgcataaattcggcagatatatcatgtcttgtatgcccaaatacatccag
cagttctcggtatggaaggacgagttgacggtgtacgtagcgccttccgccttgagaccc
accatgatatttttaaagaaccacacatctgcgcagttcaaatcagtgatggatgtcacg
gcagcagactatccttcaagatccaaccggttcgatgtcgtgtacaacatgttgtccgtg
cgttacaactcgagaatcagagtcaagacatacgccaacgaaatcagtcctgtgccttcg
attgtgcctttgtttcaaggtgccaactggtacgaaagagaaacctacgacttgtttggg
atttttttcgagggccacccggacttgagaagaattatgaccgactacgggtttgaaggc
catcctttgagaaaggatttccccaccactggatacaccgaagtgagatacgacgaggaa
aagaagagagtagtgtatgagccattggaattgacccaggcatctagaagtttcacggtt
cctcactcagcgtgggagcaggttggtgatggtaaggactttacgcccgaatcgttcaag
ttgcccacacctgaacccgagcctgaagctgaagaaaagggcgataagaagtga

DBGET integrated database retrieval system