KEGG   Yamadazyma tenuis: CANTEDRAFT_114493Help
Entry
CANTEDRAFT_114493 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cten  Yamadazyma tenuis
Pathway
cten00260  Glycine, serine and threonine metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CANTEDRAFT_114493
Enzymes [BR:cten01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CANTEDRAFT_114493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 18247447
NCBI-ProteinID: XP_006687369
JGI: Cante1_114493
UniProt: G3B5A7
Position
Unknown
AA seq 376 aa AA seqDB search
MTVLDTPQYPTHNEFRSDTFTVPTQSMLDSAYHATFGDSVYKEDQSTLDLESYMCQLTGK
EAALFCVSGTLSNQVGLRANLYQPPYSVLCDYRSHVYLHEAGGLATLSQAMVHPVVPANG
NHLTLDDVLRNYTPDNADIHAAPTKVISLENTLHGIVMPIEHIRQISQFARDNGIKLHLD
GARLWNASVETGVSIKEYCSYFDSVSLCLSKSLAAPMGSILVGSRVFVEKANHFKKQNGG
GIRQAGMMTAMALTAIKENMPRLHVAHEYARDVGRFCTDHGIKLESPVDTNFVFLDMAAN
RMSQDRLIAIGHNHNIKIMGNRISFTFQNSQESVDVLKDVILECYKEAQVNPYYGIASNK
QLYNYKSVLRSGEETK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcctcgacacaccacaatatcccacacacaatgagttcagaagtgacacgttc
actgtgcccacccagtcgatgctcgactccgcctaccacgccacctttggagactcggtg
tacaaagaagaccaaagcactttggacctcgaatcctacatgtgccaactcaccggcaaa
gaggccgcattgttctgtgtcagcggaaccttgtccaaccaggttgggttgagagccaac
ttgtaccagcctccatattcggttctctgtgattacagatcacacgtctatctacacgaa
gccgggggattggcaacactctcacaggcgatggtgcacccggttgttcccgctaatgga
aaccacttgactttggacgacgttctccgcaattacacgccagacaacgccgacatccac
gcggctcccacgaaggtgatttccctcgaaaataccctccacggaatcgtgatgcccatt
gagcatatccgccagatcagtcagtttgcccgggataatggcattaagcttcacttggat
ggggctcgtttgtggaacgcatcggtagaaacaggtgtttcaattaaagaatattgcagc
tacttcgactcggtttctttgtgcttgtcaaagtcgttggcagctcccatggggtcgata
ctagtggggctgcgggtgtttgtggaaaaggctaaccactttaaaaagcaaaatggaggg
ggaatacggcaggcggggatgatgacagccatggcgctcacggccattaaggagaatatg
ccccggcttcatgtggcccacgaatacgcccgggatgtcggtcggttctgcactgatcac
ggcattaaacttgagagtccggtcgacaccaatttcgtgtttctcgatatggctgcaaac
agaatgagtcaagaccgattgatcgcaattggtcacaatcacaacattaaaattatggga
aatcggatatcctttacgttccagaatagccaagaaagtgtggatgttctaaaagacgtg
attcttgagtgctataaagaagctcaggtcaatccgtactatgggatcgcatctaataag
cagttgtataattacaagctggtgttaagatcaggggaagaaacaaaataa

DBGET integrated database retrieval system