KEGG   Yamadazyma tenuis: CANTEDRAFT_115780Help
Entry
CANTEDRAFT_115780 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K06667  serine/threonine-protein kinase CAK1 [EC:2.7.11.22]
Organism
cten  Yamadazyma tenuis
Pathway
cten04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cten00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CANTEDRAFT_115780
Enzymes [BR:cten01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CANTEDRAFT_115780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 18248011
NCBI-ProteinID: XP_006689023
JGI: Cante1_115780
UniProt: G3B7T7
Position
Unknown
AA seq 310 aa AA seqDB search
MNVIYNGPYSNVYREDKYAVKKVDRDFSLPPHNIDRELQLVKSLDHPNVIKFLKVENKLD
DVMMYMEFYPQNLQEYLKANCRKKSRFVVGQVSFVTESRLSLDSIAHVLDQVIEAIWFVH
KNGIIHRDIKPSNFLVTQEPELRVVLCDFSISVAVGENDQISDVCSTYYKPLEVIFGLEY
GLEIDVWGLGIMISHLYSRSCTNTLFEEEDINDGYRAISDFKIIDRIFKRFGTPTKDDEN
SINYWPEIFEVENFQLIQLNSRPRQLDIFPRGTDEKMVTLFNRICDMNQKRRIAMSEVRD
RWTQIREGSS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttatatacaatgggccatattctaatgtgtatcgcgaggacaaatacgctgtc
aagaaagtagatcgggactttagtctaccaccacacaacatcgatagggagctccagctt
gtgaaatcactagaccatcccaatgtgatcaagtttctcaaggtggaaaacaagcttgac
gatgtgatgatgtacatggagttctatccacaaaaccttcaggagtacttgaaggccaat
tgcagaaaaaagagccggtttgtggtcggccaagtgctgtttgtgaccgaaagccggctt
tcgcttgactcaattgcacatgtgcttgaccaggtcatcgaggctatctggtttgtgcac
aaaaatggcataattcaccgggatatcaagcccagcaatttcttggtgactcaagagccc
gagttaagagtggttctttgcgacttcagtattctggttgccgttggcgaaaatgatcag
attctggatgtgtgttcaacctactacaagccattggaggtgatatttggacttgagtac
gggcttgaaatcgacgtctggggattggggatcatgattctgcatttgtattctagaagt
tgcacaaatacgttatttgaagaggaagacatcaatgatggttacagagccatcagcgac
tttaagatcatagatcgcatattcaagcgattcggcacccccaccaaagacgacgaaaat
agcattaactactggcctgaaattttcgaggttgagaatttccaattgatacagttgaac
tcccgccccaggcagcttgatatcttccctcggggtacggacgagaagatggtgacgctt
ttcaaccggatttgtgacatgaaccagaagcgcaggattgcgatgagcgaggtgcgagat
cggtggacgcagataagagaaggtagcagttaa

DBGET integrated database retrieval system