KEGG   Yamadazyma tenuis: CANTEDRAFT_115799Help
Entry
CANTEDRAFT_115799 CDS       T03099                                 

Definition
(RefSeq) alpha subunit of succinyl-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cten  Yamadazyma tenuis
Pathway
cten00020  Citrate cycle (TCA cycle)
cten00640  Propanoate metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01200  Carbon metabolism
Module
cten_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cten_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CANTEDRAFT_115799
   00640 Propanoate metabolism
    CANTEDRAFT_115799
Enzymes [BR:cten01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CANTEDRAFT_115799
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CANTEDRAFT_115799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 18248024
NCBI-ProteinID: XP_006689035
JGI: Cante1_115799
UniProt: G3B827
Position
Unknown
AA seq 323 aa AA seqDB search
MFNKQFTRGIASSQPARNYASTIKNLKINSDTKVIYQGFTGKQATFHAEQAIAYGTKVVG
GTNPKKAGTTHLDKPVFASVKDAIKQTGADATGIFVPPSIAAKAIEEAIEAEISLAVAIT
EGIPQHDMVRIAQILKTQEKTRLVGPNCPGIIAPEQCKIGIMPSSIHKRGKVGIISKSGT
LTYEAVAQTTTVGLGQSLVIGMGGDPFPGTNYIDVLTLFLNDPETEGIILIGEIGGTAEE
EASEFLKQYNLTRDVPKPVVSFIAGVSAPPGRRMGHAGAIVAGGKGDAKSKIAALESAGV
VVEKSPARLGNSLLAEFKAKGLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaagcaattcacccgtggtattgcctcttcacaaccagccagaaattacgct
tctaccatcaagaacttgaagattaattctgacaccaaagttatctaccaaggtttcact
ggaaaacaagctactttccatgctgaacaagccattgcttacggcaccaaagttgtcggt
ggtaccaatcccaagaaagccggaaccacccacttggacaagccggtgtttgctagtgtc
aaggatgccataaagcaaactggtgccgatgccacaggtattttcgtcccaccttcaatt
gccgccaaagccatcgaagaagccatcgaggccgaaatctccttggccgtggccatcacc
gaaggtattcctcaacacgacatggtcagaattgcccagatcttgaagacccaggaaaag
accagattggtgggtccaaactgtccaggtataattgctcctgaacaatgtaagattggt
atcatgccttctagcatccacaaaaggggtaaggttggtatcatttccaagtccggaacc
ttgacctatgaagcggttgctcaaaccaccaccgtgggattgggtcaatctttggtcatt
ggtatgggtggtgacccattccccggtaccaactacatcgacgtcttgaccttgttcttg
aacgaccctgaaaccgaggggatcattttgattggggagatcggtggtactgctgaagaa
gaagcttctgagttcttgaaacaatataacttgaccagagacgtgccaaagcctgttgtt
tccttcatcgctggtgtttctgctcctccaggtagaagaatgggtcacgccggtgccatt
gtcgctggtggtaaaggtgacgctaagagtaagattgcagctttggaatccgctggagtg
gttgtggaaaagtctcctgctagattaggtaactccttgttggctgaattcaaggccaag
ggattattgtaa

DBGET integrated database retrieval system