KEGG   Yamadazyma tenuis: CANTEDRAFT_115844Help
Entry
CANTEDRAFT_115844 CDS       T03099                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolase protein
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
cten  Yamadazyma tenuis
Pathway
cten00240  Pyrimidine metabolism
cten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CANTEDRAFT_115844
Enzymes [BR:cten01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     CANTEDRAFT_115844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylate_kin KTI12 dNK AAA_18 HMW1C_N AAA_16 Pro_3_hydrox_C AAA_33
Motif
Other DBs
NCBI-GeneID: 18248049
NCBI-ProteinID: XP_006688554
JGI: Cante1_115844
UniProt: G3B8F2
Position
Unknown
AA seq 216 aa AA seqDB search
MRGHLILIEGLDRSGKSTQVERLHTAIPNSSTQKFPDRSTRIGAIINQYLTDESFVLPDQ
SIHLLFSANRWELIDSMSRALQSGTTVILDRYIYSGIAYSLAKSHFNHSDNQMASVEWLY
SPDKGLLKPDLTLFLTLNMDEIDTRADFGDERYEKRAFQEVVKDNFLRLLDPKVDSSIHF
IDVNRQSIDEVGRTIWDVVEGGSFHQLTDQPLQFFS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagaggacatcttatattaatagaaggcttggaccgatccggcaagtccacccaggtt
gaacggcttcacaccgccatccccaactcatctacccagaagttccccgatcggtccacg
cgaattggtgctatcatcaatcagtacctcactgatgaactgtttgtattgcccgaccaa
tcgattcatcttctattcagcgccaaccggtgggaactcatcgacctgatgtcccgggcg
ttgcagagcggtactacggtcatcctagaccgctacatctattcaggcatcgcttactcg
cttgccaaactgcattttaaccatagtgataaccaaatggcgtctgtagaatggctttat
tccccagacaagggtcttctcaaaccggacctcacgctcttcttgactttgaacatggac
gagatcgatacgcgggcagactttggggacgagcggtacgagaagagggctttccaggag
gtggttaaggacaactttctccggcttttagatcccaaggtcgactcgtcgattcacttt
atagacgtcaaccgccagtcgattgatgaggtggggcgcaccatctgggacgtggtggag
ggcggcctgttccaccagctcaccgaccagccccttcagttctttagctga

DBGET integrated database retrieval system