KEGG   Yamadazyma tenuis: CANTEDRAFT_116395Help
Entry
CANTEDRAFT_116395 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cten  Yamadazyma tenuis
Pathway
cten00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CANTEDRAFT_116395
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CANTEDRAFT_116395
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CANTEDRAFT_116395
    1.1.1.-  
     CANTEDRAFT_116395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 18248283
NCBI-ProteinID: XP_006690313
JGI: Cante1_116395
UniProt: G3BDN6
Position
Unknown
AA seq 382 aa AA seqDB search
MKAIVYHGKNDLRFHSDYIEPQVQHPEDVKIKVYYCGICGSDLKEYTSGPFFFNKPGTTN
PISNLQFPMVLGHEMSGEVISVGFGVTSLKVGDKVVVEVTGTCKDKHRFEESPAKDKPEC
GACEDGHYNACDNLALTGLGFSDGGCAEYVVTTQSKLIKFDEKKIPMDIAALVQPLAVSW
HAVKVSRLEEGQSALILGGGPIGLTTIFALKGHKASKIVVSEPALARRLLAEKLDVMTFD
PTGKSVEDCVKELRALSPGNHGFHHTFDCSGISSTFETSIKCLRIRGTATNVAVWAKKYI
QYSPMDTTLSEKIVTGSICFVKSDFEAVVNCIEAGDIDVNELRLMITDKILLDNGVKEGF
DELLSNKEKHIKMLFTAYRELL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgtgtaccacggcaagaatgatttgcgattccacagtgactacattgaa
cctcaagtacagcatccagaagatgtgaagattaaggtgtactactgtgggatttgtggg
tctgacttgaaagagtataccagcggacccttctttttcaataaacctggaaccaccaac
cccatttccaacttgcagttcccgatggtattgggccacgagatgagtggtgaagtgatc
tctgttggatttggtgttactctgttgaaggttggtgataaggtggtggtggaggtaaca
ggaacttgtaaagataaacatcggtttgaagagtcgcctgcgaaggacaagcccgagtgt
ggtgcttgtgaagatggtcactataatgcttgtgacaacttggcattgacgggattaggg
tttagtgatggaggttgtgctgagtatgttgtcaccactcaatcgaagttgattaagttt
gacgaaaaaaagatccctatggatattgctgcattggtacagcctttggcagtttcatgg
cacgccgtgaaggtgtctcggttggaagagggacaatcagcattgatcttgggaggaggt
cccattggtttgaccactatttttgctttaaaaggtcataaggcaagtaagattgtggtc
agtgagccagctcttgccagaaggctattggcagaaaaattggatgtgatgacttttgat
cctactggaaaatccgtggaagactgtgttaaggaattgcgggctttgtctccaggaaat
catggattccatcacacttttgactgtagcggaataagttcgacctttgaaaccagtatc
aaatgtcttcgaatcagaggtaccgccaccaacgtggcggtgtgggcgaagaaatacatc
cagtattcgccaatggatactaccttgagcgagaaaatcgtcactgggtccatttgtttt
gtcaagtctgatttcgaagctgtagttaattgtattgaagcgggtgatatcgatgtcaat
gaactcaggttgatgattacagataaaatattgctcgataatggggtcaaagaaggattc
gacgagttgttgagcaacaaagagaaacatatcaagatgctttttactgcttatagagag
cttctctag

DBGET integrated database retrieval system