KEGG   Yamadazyma tenuis: CANTEDRAFT_116881Help
Entry
CANTEDRAFT_116881 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
cten  Yamadazyma tenuis
Pathway
cten00600  Sphingolipid metabolism
cten01100  Metabolic pathways
Module
cten_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CANTEDRAFT_116881
Enzymes [BR:cten01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     CANTEDRAFT_116881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat S-methyl_trans
Motif
Other DBs
NCBI-GeneID: 18248485
NCBI-ProteinID: XP_006690030
JGI: Cante1_116881
UniProt: G3BCE4
Position
Unknown
AA seq 494 aa AA seqDB search
MSSSSERLLLPQSGTRCRVENTGLVIIDQSLLNPAHSSSYACFPSGASGPTSRTILFEDI
LWCEQLHETTYAVTYATPIGTNIDTMTFTATIDDVPTAYTPTQSQDLSAHILQRAYGTSI
VKPSVLVLINPHGGQGKAKSIYTHRIQPVLEAAKADITVIETLYSKHAMDVARELDIDKY
DIIACCSGDGIPHEVINGFYQRPDKGAAAFNKLVVTQLPCGSGNALTLSTHGSNRAAVAT
FRMLKSEKTQMDLMALTQLDDDGHEQTSLSFLSQCYGAISDSDIGTEHLRWMGPIRFDLG
VVQRTLSRAVYPCEVYVKYLTTTKDELVSYFNQCVGQAKETHVITKETLDIKGPKLTESP
PSDWIQVDQSLTDNLSIFYVGNMPMVSSNTQFFPAALPNDGSMDMIITDARTSLPKALRA
LLAIEKGTHVDELFVSHHKVTSYRLVPKLPENSKHYLSVDGEDFPFRAFQVEVLPSVLTT
LTSDGNYVPTSFRN
NT seq 1487 nt NT seq  +upstreamnt  +downstreamnt
ccatgtcttcttcctcagaaagacttcttcttccacaatcaggcacccggtgccgtgttg
aaaacactggcttggtgatcattgaccagtcgcttctaaaccccgcacattcgctgtctt
acgcctgtttccccagcggtgccagtggccctacctcccgcaccattcttttcgaagaca
tattatggtgtgaacagctccatgaaaccacatacgccgtcacgtacgccacgcctatcg
gcaccaacattgacaccatgaccttcactgccaccattgacgacgtgcctactgcgtata
cacccacccagtcacaggatctcagtgctcacattttgcaacgggcgtacggcacaagca
ttgtgaagccgtcagtgttggtgctcatcaatccccacggtggccagggcaaggccaaga
gtatctacacgcaccgtatccagccggtgttggaggcggccaaggcagacattacggtga
tagaaacactatactccaagcacgcgatggacgtggcccgagaattggatatagacaaat
acgacatcattgcgtgctgctccggcgacgggatcccgcacgaggttatcaacgggttct
accagcggccagataaaggtgctgctgccttcaacaagttggtggtgacacaattaccgt
gtgggtctggaaatgcgttgacgttgagcactcatggcagtaatcgggctgccgtggcca
ccttccggatgttgaagtcagagaagacgcagatggatctcatggctctcacccaacttg
acgatgatggccacgagcaaaccagtctttcgtttctctctcagtgctatggtgccatat
cagatagcgacataggtactgaacacttgcgatggatgggtcctattcggttcgacttag
gggtggttcagaggacgttgagcagggctgtgtatccttgtgaagtgtatgtcaagtact
tgaccaccaccaaggatgagttggtgtcgtatttcaaccaatgcgttggccaggctaaag
aaacgcatgttatcaccaaagaaacccttgacataaaggggcctaagctcaccgagagcc
ccccatctgattggatccaggtggaccagagtttgaccgacaacttgagtatcttctacg
tgggaaacatgcctatggtttcgtcaaacactcagttttttcctgctgctcttcctaatg
atggttcaatggacatgatcatcactgacgcccgtacgtcgcttcctaaagcattgcggg
cattgttggcaattgagaaaggaactcacgtcgatgagctctttgtttctcatcacaagg
tgactagctatcgattggtgcccaaattaccggagaattcgaaacactatctctcggtag
atggagaagacttcccgttcagagccttccaggtagaggtacttccgagcgtgttgacta
cgttgacgagtgacgggaactacgtgcccaccagcttccgcaattag

DBGET integrated database retrieval system