KEGG   Yamadazyma tenuis: CANTEDRAFT_119196Help
Entry
CANTEDRAFT_119196 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K01405  saccharolysin [EC:3.4.24.37]
Organism
cten  Yamadazyma tenuis
Brite
KEGG Orthology (KO) [BR:cten00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cten01002]
    CANTEDRAFT_119196
Enzymes [BR:cten01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.37  saccharolysin
     CANTEDRAFT_119196
Peptidases and inhibitors [BR:cten01002]
 Metallo peptidases
  Family M3
   CANTEDRAFT_119196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 18248688
NCBI-ProteinID: XP_006684633
JGI: Cante1_119196
UniProt: G3AZC1
Position
Unknown
AA seq 674 aa AA seqDB search
MSEIDYDNLISKLSLPRWDHTPSQVLQKAEDLIRIQDECLNKFAAVENPTTENALAPYLQ
TVQEIWFSEGQLTFYSSVSPQKDVRDASNAVSKKLDKYSIEASQRKDVYKVFKKLAEAKH
SDPETTRYLDKKVLGYQRNGMELPDDQQEVLKNYKLQLSELAIEFKRALNEIDEYIAFTR
EELEGVPDDVVDQFQIDGGKYKMTFKYTDFFPVMKYAKNQDTRKRAYIGNQSKCANNGTI
LLNMLKLRYRVAKLLNYDHYSAFVLEERIAKTSDNVLTFLHDLRAKLTPLGKQQLQHMKE
LKYKDLRSRELSPQDDFYIWDQSFYDNLLLEKEYQVDHKKIQEYFPLDLTIKRMLSIYET
IFDIKFHKLANLPVEFTWHSEVKQFAVFQNIKSGNPSFVGIIYFDLHPREGKYGHAANFN
LGPGFEKGDGTRQYPVTALVCNFTKPSKDKPALLKHSELKTFFHELGHGVHSILSKTKYA
KFHGTRVPRDFVEAPSQMLEYWIWSQDELKALSSHYQTGEPISDELLGQLIKSKSVNRAL
LNLRQVFLGLFDMKCHTIDNEEDLETFDLLSTWNDMRGDISLIPADAIRTPGYASFRHIA
LGYSSSYYGYLYSQVFAADMFYSLFKKDPMNIQSGLRYRDVILSTGNSREIMESLEELLG
RKPTNTAFLKELLG
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaatcgactacgataacctcatttccaagctttcacttcctcggtgggaccac
acgccctctcaggttcttcagaaagcagaagacttgatacgtatccaagacgaatgcctc
aacaaattcgctgctgttgagaaccctactacagaaaacgcgttggctccgtacttgcaa
acagtgcaagaaatatggttttccgagggccaattgacattctacctgtctgtgtctcca
cagaaggatgtgagagacgcctccaatgccgtgctgaagaagctagacaagtactcgatt
gaggctctgcagaggaaagacgtctataaagtgttcaagaaattggcagaagccaaacac
ctggacccggaaactactcgttacttggataagaaggtgttgggataccaaagaaatggc
atggaattgccggatgaccagcaggaagttctaaagaattataagcttcagctctctgag
cttgcgattgaatttaaacgggcattaaatgaaattgacgaatatatagcttttaccaga
gaagaattggagggtgttcccgatgatgttgtggatcagttccaaatcgatggcggaaag
tataagatgactttcaagtacactgacttcttcccagtaatgaaatacgctaagaaccaa
gataccagaaaaagagcctacattggaaatcagtccaagtgtgcaaacaacggaactata
ctcttgaatatgctcaagctcaggtacagagtggccaagcttttgaactacgatcattac
tctgcttttgttttggaagagaggatagcaaaaactctggacaatgttttgacgttcctt
cacgatttgcgggctaaactaacccctttgggcaaacaacaacttcaacacatgaaagag
ttgaaatataaagatttaaggtcccgggaactttctccacaagacgatttttatatttgg
gaccagagtttttacgataacttgttgttggaaaaagaatatcaagttgaccacaagaag
atccaggagtacttcccgttagacttgaccatcaaaaggatgctatcgatatacgaaacc
atttttgatatcaaattccacaaattggccaacctccctgttgaatttacatggcactca
gaagtaaaacagtttgcagtttttcagaatattaaactgggaaacccgtcatttgttggg
atcatatactttgacttgcatcctcgagaaggtaaatacggccatgctgctaacttcaat
ttgggaccaggtttcgagaagggcgatggaacaagacaatatcctgtcaccgcattggtc
tgcaattttaccaaaccttcaaaagacaagcctgccttgttgaagcacagtgagctcaag
actttctttcatgaattgggccatggagtccacagtattctatccaaaaccaagtacgcc
aagtttcatggcactagagtccctagagactttgttgaagctccatcgcaaatgcttgag
tattggatttggtcccaagacgagttaaaagccttgtcttcccattatcaaactggagaa
cctataagtgatgaattgcttggccagctcattaaatctaaaagtgtcaatagagcctta
ttgaaccttcgtcaggtgtttttgggtctatttgacatgaaatgccacactatcgataat
gaggaagatttggaaacctttgacttattgagtacgtggaacgatatgagaggagatatt
tcgttgattcctgctgatgctattagaactccaggatatgcttcattccgccatattgct
cttggatattcctccagttattatggatatttatattcccaagtgtttgctgcagatatg
ttttattcgttgtttaagaaagatccaatgaacatccaaagtggcttgaggtatcgagat
gtcattttgtccacaggaaactcgagagaaataatggagagccttgaggagctattgggg
agaaaacccactaatacggcgttcttgaaagagcttcttggctaa

DBGET integrated database retrieval system