KEGG   Yamadazyma tenuis: CANTEDRAFT_126460Help
Entry
CANTEDRAFT_126460 CDS       T03099                                 

Definition
(RefSeq) glycoside hydrolase, family 17
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cten  Yamadazyma tenuis
Pathway
cten00500  Starch and sucrose metabolism
cten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CANTEDRAFT_126460
Enzymes [BR:cten01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CANTEDRAFT_126460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 18249174
NCBI-ProteinID: XP_006688626
JGI: Cante1_126460
UniProt: G3B941
Position
Unknown
AA seq 307 aa AA seqDB search
MKYQFLTALAATVASVNAMGDLAFNFGVQDNSGNCKSSEEFAADLKTLSSYAKIVKTYAV
SDCNTLQNLGPAADDAGFQMIAGIWPTDDDHFSSEKTALQNYLPNISKDTIKVFTVGSEA
LYRDDLSASDLADKINEIKDLLKDIKDKNGDSYGDVPVGFVDSWNVLVDGASQPAIKAAD
FTYANAFSYWQGQTLKNSSYSFFDDIMQALQVIQTTKGDTDIEFFVGETGWPTEGTNYEN
AQPGVSNAKTYFQQSVCALRAWGVNVGVFEAFDEAWKPDTSGTDDVEKHWGVFDSNSDLK
YSLDCNF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaattcttgactgctttagccgccactgtggcctctgtcaatgctatgggt
gatcttgccttcaacttcggtgtccaagacaactcaggaaactgtaagagctctgaagaa
tttgcagctgacttgaagaccttgtcttcatacgccaaaatcgtcaaaacttatgctgtt
tctgattgtaacactttacaaaacttgggaccagctgctgacgacgccggattccaaatg
attgccggtatctggccaaccgatgatgaccacttcagttctgaaaagaccgctttacaa
aactacttgccaaatatttccaaagataccatcaaggttttcaccgttggttctgaagcc
ttatacagagacgacttgtctgcatctgacttggccgacaaaatcaatgagatcaaggac
ttgttgaaggatatcaaggacaagaacggagactcatatggtgacgttccagtcgggttt
gttgactcctggaatgttttggtcgatggggcctctcaaccagctatcaaggctgccgac
ttcacctacgccaacgccttctcctactggcagggacaaaccttgaaaaactcatcatac
tccttcttcgatgatatcatgcaagccttacaggtaattcaaaccacaaagggagatact
gacattgagtttttcgttggtgaaaccggatggccaactgaaggtaccaactacgaaaat
gcccaaccaggtgtttctaacgccaagacttactttcaacaatccgtctgtgctctcaga
gcttggggtgtcaatgtgggtgttttcgaggcttttgacgaggcttggaagcctgacact
tctggtactgatgatgttgaaaaacactggggtgttttcgactctaactcagacttgaag
tattcattagattgtaacttttaa

DBGET integrated database retrieval system