KEGG   Yamadazyma tenuis: CANTEDRAFT_137235
Entry
CANTEDRAFT_137235 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cten  Yamadazyma tenuis
Pathway
cten00100  Steroid biosynthesis
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
Module
cten_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CANTEDRAFT_137235
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CANTEDRAFT_137235
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18250041
NCBI-ProteinID: XP_006689972
JGI: Cante1_137235
UniProt: G3BC19
Position
Unknown
AA seq 429 aa
MLNPQTTDIQFNGSVGAVAISLGLPALLTVFGIVLNSQSPFKSGIPFPFDWSFDRIANAA
FDKNTWIAYTTYFFGFVVLDQLVPGKYIKGVVLRDKTQLTYKINGLNFILVIVTVLLARL
YALGSLPELEFIYEHQLELTLTCCLFSFALAVFVYIYSFFPLKTPNGLGTNDRILAEPGN
SGRVVYDWFIGRELNPRIGSWDIKLFCELKPGLVLWLLINVSCLYSQYLQHGTISDSMLL
INFLQGFYIFDGILNEEGLLTMMDVVTDGFGNMLAFGDLALVPWAYSLQARYLSLNYIDL
GWPYCAATVAIAALGYYVFHSANQQKSDFKQGKLAHLKSMKTVTGSNLLVDGWWKLSQHI
NYLGDWLIGLSWCLATGFNTPLTYFYAVYFASLLVHRQVRDDEKCASKYKQSWDEYKARV
PYKIIPYLY
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgctaaacccacaaacaactgatatccagttcaatggctccgtcggtgccgtcgccatc
tccctcgggcttccagccctcctcacggtatttggtattgtcctcaactcccagtccccc
ttcaaatcaggaatccccttccccttcgactggtcgttcgatcgtatcgccaacgctgcg
tttgacaaaaacacctggattgcctacacaacctactttttcgggtttgtggttctagac
caattggtccctggcaagtacataaaaggggtcgtgttgagagacaagacccagttgacc
tacaagatcaatggcctcaatttcattcttgtcatcgtgacagttttgcttgcacggctt
tatgctctaggaagtttgcccgaactcgagtttatctatgagcatcaacttgaattgacg
ttgacgtgctgcttgttttcgtttgctttggcggtgtttgtgtatatctactcgtttttt
ccgttgaaaacgcccaatggcttgggcaccaacgacagaattcttgctgaacctggaaac
tcgggaagggtggtgtatgattggttcatcggcagggaattgaacccacgtataggtagc
tgggacatcaagttattttgtgaattgaagccgggattggtgttgtggctcctcataaat
gtgtcttgtttgtacagccagtatttgcagcatggcaccatttcagactcgatgctctta
atcaactttttgcagggattctacatttttgacgggattttgaatgaggaaggtttgttg
acaatgatggacgttgtgaccgatgggtttggtaatatgttggcatttggtgatttggcg
ttggtgccatgggcatactcgctccaagctagatatttatctttgaattatatcgatttg
ggatggccgtactgtgctgccaccgtggccatcgcagcgttgggatactacgtgttccac
tcggccaaccagcaaaagtcagactttaaacaaggaaaattggctcatttgaagtccatg
aaaaccgtcaccgggtccaatttgctcgtcgatgggtggtggaaactcagccagcacata
aattacttgggagactggctcattgggctctcgtggtgcttggctacggggttcaacacg
ccgttgacgtacttttatgcggtgtattttgcatctctcttggttcaccggcaagtacga
gacgacgaaaagtgtgccagcaagtacaaacagagctgggatgagtataaggccagagtc
ccctacaagatcattccatacctctactag

DBGET integrated database retrieval system