KEGG   Yamadazyma tenuis: CANTEDRAFT_99353Help
Entry
CANTEDRAFT_99353  CDS       T03099                                 

Definition
(RefSeq) 2, 3 cyclic phosphodiesterase
  KO
K15435  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
cten  Yamadazyma tenuis
Brite
KEGG Orthology (KO) [BR:cten00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cten03016]
    CANTEDRAFT_99353
Enzymes [BR:cten01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     CANTEDRAFT_99353
Transfer RNA biogenesis [BR:cten03016]
 Eukaryotic type
  tRNA spricing factors
   Other tRNA splicing factors
    CANTEDRAFT_99353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPDase
Motif
Other DBs
NCBI-GeneID: 18250849
NCBI-ProteinID: XP_006688509
JGI: Cante1_99353
UniProt: G3B832
Position
Unknown
AA seq 238 aa AA seqDB search
MSSLNTLFPNSPPRFDPHITITSNLVIDRAAPHDDVDRILSASAVAFDSFAKDHSHIVTL
GRVDSQRKFFKKLYFQAKKDPNLLSLTRIIRELFVILPSKIEKENQKENPHLYTNDSHGN
LVKRKPSKKDKTRNPAEQHPLKELDISRLREEAAIEAAEWTLNEFDPHLSLVYSDIYPID
SALWRTIKTRIQDYLNINECDAEDLEDNGLSWDGGVLKLVLTEGDVNDWIVLGSVEVH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgctcaatactcttttcccgaacctgccccccagattcgatccccacatcacc
atcaccagcaacttggtcatcgaccgggctgctccgcacgatgatgtggatcgaattctc
tcggccagtgccgtggccttcgactcatttgccaaagatcactctcatatagtgactctc
gggagagtcgatagccaaaggaagttcttcaaaaagctttatttccaagcaaaaaaagac
cccaatttgctttcattgacgagaattatacgtgagttatttgtcatactaccttccaag
atcgaaaaggagaaccagaaggaaaacccccatttatacactaatgacagccatgggaat
cttgtgaagcgtaaaccttcaaagaaagacaagactcgaaacccagccgaacagcatccg
ctcaaggaattggatatatctagactacgagaggaggcagccattgaagcggccgaatgg
acattgaacgagtttgatcctcatctttcccttgtgtatagtgacatctaccctattgac
agtgcattatggagaacaattaaaactcggatccaggactacttgaacattaacgaatgt
gacgccgaggacctagaagataacgggttgtcctgggacggaggtgtgttgaagttggtg
ttgacagaaggtgatgtgaatgattggatagtgttgggaagtgttgaagttcactaa

DBGET integrated database retrieval system