KEGG   Corynebacterium terpenotabidum: A606_00965Help
Entry
A606_00965        CDS       T02714                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cter  Corynebacterium terpenotabidum
Pathway
cter00061  Fatty acid biosynthesis
cter00071  Fatty acid degradation
cter01100  Metabolic pathways
cter01212  Fatty acid metabolism
cter02024  Quorum sensing
Module
cter_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cter00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A606_00965
   00071 Fatty acid degradation
    A606_00965
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A606_00965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cter01004]
    A606_00965
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cter04147]
    A606_00965
Enzymes [BR:cter01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     A606_00965
Lipid biosynthesis proteins [BR:cter01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   A606_00965
Exosome [BR:cter04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   A606_00965
  Exosomal proteins of breast cancer cells
   A606_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AGP29848
UniProt: S4XGR7
Position
237216..238937
Genome map
AA seq 573 aa AA seqDB search
MSENTWHQFYPEWVRPELDYDVAGERTLAEIFDHAVTTWPDRPAMTFFGTTVSYGEYGRQ
VRRCAAMLHNRGVRKGDRVAIALPNCPQALITFYAVVSLGATATLHNPLYTARELTIAFK
DHGAKVGVFWDKAVDVARELRTVSPLEQIIPVTITRAMPWYLQGALRIPVKPLAAMRSKL
TGSTEGLTEWGDLMKDASESEGRALLETASVGPEDIALVLYTSGTTGAPKGAGLSHRNLC
ANIIQGREWVPGLGEDEQPERMLAALPIFHAYGLTMNITLAPLVGGTVLLLPAPEKPLLA
SAMKKQKPTWVPGVPALYQTIMDLAEQKHIDISGVKASFCGAASLPVEVVKRWENMTGGL
LIEGYGLTETSPIVLGNPASQDRRPGYVGIPFPDTEVRVVSQNDPTVELPVGEAGELIAR
GPQVFGGYLNRPDANATAFVELSDGGAPWFRTGDMAVMEADGFVKIVSRIKEMIVTGGFN
VYPAEVEEVLSEHPSITAASVVGLPRSDGSETVAAGVVLAAGAQLDEEVLREHCQEGLAR
YKVPRVFKVFTELPADQLGKVRRVEVREQMLQG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacacctggcaccagttctaccccgagtgggtgcgccccgaactcgactac
gacgtcgcaggagaacgcaccctcgccgagatcttcgaccacgcggtgaccacctggccc
gaccggcccgcgatgaccttcttcggtaccaccgtctcctacggcgagtacggacgccag
gtccgccgatgcgcggcgatgctgcacaaccgtggcgtccggaagggcgaccgggtcgcc
atcgctctgccgaactgcccgcaggcgctgatcaccttctacgccgtcgtctccctcggc
gcgaccgccaccctgcacaatccgctgtacaccgcccgtgaactcaccatcgcgttcaag
gaccacggggcgaaggtcggtgtgttctgggacaaggcggtcgatgtcgcccgcgaactg
cggaccgtcagcccgctggagcagatcatcccggtgaccatcacccgcgcaatgccctgg
tacctgcagggggcgctgcggatcccggtcaagccgctggcggcgatgcgcagcaagctc
accggctccaccgaggggctgaccgagtggggcgacctcatgaaggacgcctcggaatcc
gagggacgtgccctcctcgagaccgcatcggtgggcccggaggacattgccctggtgctg
tacacctccggcaccaccggtgcgccgaagggtgcggggctgtcgcatcgcaacctgtgc
gccaacatcatccagggtcgcgaatgggtgccgggtctcggcgaagatgagcagccggag
cggatgctcgccgccctgccgatcttccacgcctacgggctgacgatgaacatcaccctc
gccccgctggtcggcggtacggtgctgctgctgcccgcgccggagaaaccgctgctggcg
tccgccatgaagaagcagaagccgacctgggtgccgggcgtccccgcgctgtaccagacg
atcatggacctcgcggagcagaagcacatcgacatctccggagtgaaggcgtccttctgc
ggtgcggcgagcctgcctgtggaggtcgtgaagcgctgggagaacatgaccggtgggctg
ctcatcgagggctacggactcaccgagacctcaccgatcgtgctcggcaatccggcgagc
caagaccggcgtcccgggtatgtgggcatcccgttcccggacacggaggtgcgcgtggtg
tcgcagaatgatccgaccgtggaactgccggtcggggaggccggtgagctgatcgcacgc
ggcccgcaggtcttcggtgggtatctcaaccggccggacgccaacgccacggccttcgtg
gaactcagcgacggaggggcgccgtggttccgtaccggtgacatggccgtgatggaggcg
gacggcttcgtcaagattgtctcgcggatcaaggagatgatcgtcaccggtgggttcaac
gtgtacccggctgaggtcgaggaggtgctgagtgagcatccgtcgatcactgcggcgagt
gtggttgggctgcctcggtcggacgggtcggagactgtcgctgccggtgtggtgctggcg
gccggggcgcagctggatgaggaagtcctccgggaacactgccaggaggggctggcccgc
tacaaggtgcctcgggtgttcaaggtcttcactgagctaccggccgatcagctgggcaag
gtgcggcgcgtcgaggtgcgggagcagatgctgcaggggtga

DBGET integrated database retrieval system