KEGG   Corynebacterium terpenotabidum: A606_01195Help
Entry
A606_01195        CDS       T02714                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cter  Corynebacterium terpenotabidum
Pathway
cter00071  Fatty acid degradation
cter00072  Synthesis and degradation of ketone bodies
cter00280  Valine, leucine and isoleucine degradation
cter00310  Lysine degradation
cter00362  Benzoate degradation
cter00380  Tryptophan metabolism
cter00620  Pyruvate metabolism
cter00630  Glyoxylate and dicarboxylate metabolism
cter00640  Propanoate metabolism
cter00650  Butanoate metabolism
cter00900  Terpenoid backbone biosynthesis
cter01100  Metabolic pathways
cter01110  Biosynthesis of secondary metabolites
cter01120  Microbial metabolism in diverse environments
cter01130  Biosynthesis of antibiotics
cter01200  Carbon metabolism
cter01212  Fatty acid metabolism
cter02020  Two-component system
Module
cter_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A606_01195
   00630 Glyoxylate and dicarboxylate metabolism
    A606_01195
   00640 Propanoate metabolism
    A606_01195
   00650 Butanoate metabolism
    A606_01195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A606_01195
   00072 Synthesis and degradation of ketone bodies
    A606_01195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A606_01195
   00310 Lysine degradation
    A606_01195
   00380 Tryptophan metabolism
    A606_01195
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A606_01195
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A606_01195
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A606_01195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cter04147]
    A606_01195
Enzymes [BR:cter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A606_01195
Exosome [BR:cter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A606_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGP29894
UniProt: S4XBQ3
Position
complement(296278..297513)
Genome map
AA seq 411 aa AA seqDB search
MTDATASGIPEAFIYDAVRTPRGKGKPGGSLHTVKPVDLLSGLITETLARNPELDPAAIE
DIIAGVVTPLGDQGMDIARTAALNAGLPYSATGVQINRYCASGLSAVNFGAMKVRSGFDD
LVLAGGVESMSRVPMGADGGALAMDPTTSFYNDFIPQGISADLIATLDGVTREDLDAYAA
RSHARATLAWDEGRFDRSVVPVKDANGLTLLDRDETIRTGTTVETLAGLRPAFAVVGDQG
GFDAVALNKYPQVEKINHVHHGGNSSGIVDGASLLLIGNETAGQRYGLTPRARIVAAATT
GVEPTIMLTAPAPAARAALAKAGLTAEDIDVWEINEAFSSVVLRAQRDLNIPDEKLNING
GAIAMGHPLGATGGIITGTAVDELHRSGGRYALITLCVAAGMGVATIIERV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgccaccgcctcgggaatccccgaggcattcatctacgacgccgtccgcacc
ccgcggggcaagggcaagccgggcggttcgctccacaccgtcaagcccgtcgacctgctg
tccggcctgatcaccgagactctcgcccgcaaccctgagctcgaccccgccgccatcgag
gacatcatcgccggtgtcgtcaccccgctcggcgaccagggcatggacatcgcccgcacc
gccgccctcaacgccggcctgccgtactccgccaccggcgtgcagatcaaccgctactgc
gcttccggcctctccgccgtgaacttcggcgcgatgaaggtccgctccggcttcgatgac
ctcgtgctggccggtggcgtggagtccatgtcgcgggtcccgatgggtgccgacggcggc
gccctggccatggatccgaccacctccttctacaacgacttcatcccgcagggcatctcc
gccgacctcatcgccacccttgatggcgtcacccgcgaggatctcgacgcctacgccgcc
cgctcccacgcccgcgccaccctggcctgggacgagggacggttcgaccgctccgtcgtc
ccggtgaaggacgccaacggtctcaccctcctcgaccgcgacgagacgatccgaaccggc
accaccgtcgagacgctcgccggtctgcgccccgccttcgccgtcgtcggtgaccagggc
ggcttcgacgccgtggcactgaacaagtacccgcaggtcgagaagatcaaccacgtccac
cacggtggcaactcctccggcatcgtcgacggcgcgtccctgctgctcatcggtaacgag
accgccggtcagcgctacggcctgaccccgcgtgcccgcatcgtcgccgccgcgaccacc
ggtgtcgagccgaccatcatgctcaccgcccccgccccggccgcccgcgctgccctggcc
aaggccggcctgaccgccgaggacatcgacgtctgggagatcaacgaggccttctcctcg
gtcgtcctgcgtgcccagcgtgacctcaacatcccggacgagaagctgaacatcaacggt
ggcgcgatcgcgatgggtcacccgctgggtgccaccggcggcatcatcaccggtaccgcc
gtcgacgagctgcaccgttccggtggccgctacgccctgatcaccctctgtgtcgccgcc
ggtatgggcgtcgccaccatcatcgagcgagtctga

DBGET integrated database retrieval system