KEGG   Corynebacterium terpenotabidum: A606_07965Help
Entry
A606_07965        CDS       T02714                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cter  Corynebacterium terpenotabidum
Pathway
cter00072  Synthesis and degradation of ketone bodies
cter00280  Valine, leucine and isoleucine degradation
cter00650  Butanoate metabolism
cter00900  Terpenoid backbone biosynthesis
cter01100  Metabolic pathways
cter01110  Biosynthesis of secondary metabolites
cter01130  Biosynthesis of antibiotics
Module
cter_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A606_07965
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A606_07965
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A606_07965
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A606_07965
Enzymes [BR:cter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     A606_07965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGP31238
UniProt: S4XKW8
Position
1848434..1849621
Genome map
AA seq 395 aa AA seqDB search
MTAIGIHDLELATGHHVLELTDLAESQGVVPGKYILGLGQSQFSVLSEDEDIVTMGAAAA
LPLLERNGIEGIRTLLFATESGVDQSKAAGVAALRLLGLPSGVRTVEMKQACYGGTAALQ
AAIGIVARAPEEKVLVIASDNARYLLDSPGEPTQGAGAVAMLVSADPALLEIEPINGIST
TDVDDFWRPNDSTTAVVDGHLSVGAYLDALSDAWKDLEGRGGPAIGDIDRILYHQPYTKM
AKKAQQRLREVTGEEISTALNPGDEVDGRDTGLETGSRYNRRLGNSYTASLYAGLASLLD
HDDELAGKRIGLFSYGSGCVSEFFTGIVQEGYREVRAASHVEDVLDARVPVTVAEYRDLH
NAPHGTSTDQVTPAVTTGPFRFAGVADQARRYEVR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatcggtatccacgacctggagcttgccaccgggcatcatgttctcgagctc
actgacctcgccgaatcccagggggtggtcccgggaaagtacattctcggtctcggccag
tcacagttcagcgtcctgtccgaggacgaggacatcgtcaccatgggcgcggcagctgct
ctcccgctgctggagcgcaacggcattgaggggatccgcaccctcctcttcgccaccgag
agcggcgtggaccagtccaaggccgccggtgtggccgcgctgcgtctgctcggactgccg
tccggtgtccgcaccgtcgagatgaagcaggcctgctacggcgggaccgccgcactgcag
gccgccatcggcatcgtcgcccgcgccccggaggagaaggtcctcgtcatcgccagcgac
aacgcccgctacctgctggattccccgggcgagccgacccagggtgccggtgcggtcgcg
atgctcgtctccgccgaccccgctctgctggagatcgaaccgatcaacggcatctccacc
accgatgtcgacgatttctggcgtccgaacgattccaccaccgccgtcgtcgacggtcac
ctgtccgtcggcgcctacctcgacgcactgtcggacgcctggaaggacctggaaggacgc
ggcggcccggcgatcggcgacatcgaccgcatcctctaccaccagccgtacacgaagatg
gcgaagaaggcgcagcagcgcctgcgggaggtcaccggtgaggagatcagcaccgcactg
aacccgggtgacgaggtcgacggccgggacaccggtctggagaccggatcacgctacaat
cgccgcctcggcaacagttacaccgcctcgctgtacgccggcctggcgtccctgctcgac
cacgacgatgagctggcggggaagcgcatcggcctgttcagctacgggtccgggtgcgtc
tccgagttcttcaccggcatcgtgcaggagggttaccgcgaggtccgcgcggcgtcccac
gtcgaggacgtgctggacgcccgcgtcccggtgaccgtcgccgagtaccgtgacctgcac
aacgcaccgcacggcaccagcaccgaccaggtcaccccggccgtgaccaccggtccgttc
cgcttcgcgggggtggccgaccaggcccgccgctacgaggtgcgttga

DBGET integrated database retrieval system