KEGG   Comamonas testosteroni TK102: O987_03535Help
Entry
O987_03535        CDS       T03218                                 

Definition
(GenBank) cytidyltransferase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00760  Nicotinate and nicotinamide metabolism
ctes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O987_03535
Enzymes [BR:ctes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     O987_03535
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     O987_03535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn HIGH_NTase1
Motif
Other DBs
NCBI-ProteinID: AIJ44876
UniProt: A0A076PJH4
Position
complement(787614..788774)
Genome map
AA seq 386 aa AA seqDB search
MPQASPNTSSKRVIAAAPETLPTSVPLHTAVLIGRFQPLHNGHMALLHAALERARQVVVV
LGSAWQAPNPKNPFSWQERAQMLRNALSKEDAERVRCVPVRDYYNEPLWVHAVREAVQAH
VPEGASVALVGHFKDSSSSYLARFPGWELISLPRLGQFDATPLREIFFGEGDTSPETMEA
ALVRLSSQMPESTLDFLRRWAQTPLYLRLQKEWHMLQDYKRAWAKAPYAPVFVTVDALLR
CRAKGQDQVLLIQRGHAPGQGLWALPGGFLEQRDSLWQSCMRELREETCSSISEADLLAA
LQAVQVFDHPDRSLRGRTITHVHYLDLGVQPSLPPVQGADDAALARWVPVADLPLMEAEF
FEDHFQILCQFLPVTLAQSEPERQVA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagccagtcccaacacctccagcaagcgtgtcatcgccgccgcacccgagact
ctgcccacctccgtgcccctgcataccgccgtgctgatcggccgctttcagccactgcac
aacggccatatggctttgctgcacgccgcgctggagcgtgctcgccaggtcgtggtggta
ctgggcagcgcctggcaggcacccaatcccaaaaacccgttcagctggcaggagcgtgcg
cagatgctgcgcaatgcgctatcgaaagaggatgccgagcgcgtgcgctgcgttcccgtg
cgcgactattacaacgagccgctgtgggtgcatgccgtgcgcgaagccgtgcaggcccat
gtacccgaaggcgcgagcgtggccctggtcggacatttcaaggactccagcagcagctat
ctggcacgctttccgggctgggagctgatcagcctgccgcgcctgggccagttcgacgcc
acgccgctgcgcgaaatcttcttcggtgagggcgacacctcgcccgagaccatggaggcc
gccctggtcaggctttcctcccagatgccagagagcacgctggactttttgcgccgctgg
gcccagacaccgctgtatctgcgcctgcaaaaagagtggcatatgctgcaggactacaag
cgggcctgggccaaggcaccttatgcaccggtgttcgtcaccgtggatgcactgctgcgc
tgccgtgccaagggccaggaccaggtgctgctgatccagcgcggccatgctccgggccag
ggcctgtgggcgctgcccggcggctttctggagcagcgtgacagcctctggcaatcctgc
atgcgcgagctgcgtgaagaaacctgctcctccatcagcgaggccgatctgctggcagcc
ctgcaggccgttcaggtcttcgatcacccggaccgcagcctgcgcgggcgtaccatcacc
catgtgcactatctggatctgggcgtgcagcccagtctgcccccggtacagggcgcggac
gacgcagccctggcccgctgggtgccggttgccgacctgcccctcatggaagccgagttc
ttcgaggaccatttccagatcctgtgccagttcctgcccgtgaccctggctcagagcgag
cccgagcgccaggtcgcctga

DBGET integrated database retrieval system