KEGG   Comamonas testosteroni TK102: O987_07325Help
Entry
O987_07325        CDS       T03218                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00071  Fatty acid degradation
ctes00072  Synthesis and degradation of ketone bodies
ctes00280  Valine, leucine and isoleucine degradation
ctes00310  Lysine degradation
ctes00362  Benzoate degradation
ctes00380  Tryptophan metabolism
ctes00620  Pyruvate metabolism
ctes00630  Glyoxylate and dicarboxylate metabolism
ctes00640  Propanoate metabolism
ctes00650  Butanoate metabolism
ctes00900  Terpenoid backbone biosynthesis
ctes01100  Metabolic pathways
ctes01110  Biosynthesis of secondary metabolites
ctes01120  Microbial metabolism in diverse environments
ctes01130  Biosynthesis of antibiotics
ctes01200  Carbon metabolism
ctes01212  Fatty acid metabolism
ctes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O987_07325
   00630 Glyoxylate and dicarboxylate metabolism
    O987_07325
   00640 Propanoate metabolism
    O987_07325
   00650 Butanoate metabolism
    O987_07325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O987_07325
   00072 Synthesis and degradation of ketone bodies
    O987_07325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O987_07325
   00310 Lysine degradation
    O987_07325
   00380 Tryptophan metabolism
    O987_07325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O987_07325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O987_07325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O987_07325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctes04147]
    O987_07325
Enzymes [BR:ctes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O987_07325
Exosome [BR:ctes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O987_07325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF3320
Motif
Other DBs
NCBI-ProteinID: AIJ45611
UniProt: A0A076PLR1
Position
1588673..1589827
Genome map
AA seq 384 aa AA seqDB search
MSAQAYIVDALRSPTGKRKGSLAAVHGADLGAHVIKALVERNDIPAADYDDVIFGCVDTI
GALAGDIARTSWLAAGMPLNVPGTTIDRQCGSSQQAIHFAAQAVMSGTQDVVLAGGVQTM
SAIPISSAMLAGQPLGFSTPFAESKGWQARFGSAPVNQFYAAQRIADHWGLSRGDMEVFA
KESHDRALKAIAEGRFDREIVPFGDFGMDETARLSTLEKMATLEPVDPTYPSITAAVSSS
TCDAAAAVLVVSEAALKRYHLTPRARIHHMSVRADDPIWHLTAPIPATEHALKKAGMTMS
DIDLVEINEAFASVVMAWLKETGYDPARTNVNGGAIALGHPLGASGAKLMTTLLHELERT
GGRFGLQTMCEGGGQANVTIIERL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccaggcctatatcgttgatgcactgcgctcgcccaccggcaagcgcaagggc
tctcttgccgccgtgcacggcgccgatctcggcgcccatgtgatcaaggcgctggtcgag
cgcaacgacattcccgcagccgattacgacgacgtgatctttggctgcgtggacaccatc
ggcgccctggccggcgacatcgcccgtacttcctggctggcggccggcatgcccctgaat
gtgcccggcaccacgatcgaccgccagtgcggatcgtcccagcaagccattcattttgcg
gcccaggccgtgatgagcggcacgcaggatgtggtgctggccggtggcgtgcagaccatg
agcgcgattccgatctcgtcggccatgctggccggtcagcctctgggctttagcacgccg
tttgccgagagcaagggctggcaggcccgcttcggcagcgcgcccgtcaaccagttctat
gccgcccagcgcattgccgatcactggggcctgagccgcggcgacatggaggtgtttgcc
aaggaaagccatgaccgggccctgaaggcgattgccgagggacgcttcgaccgtgaaatc
gtgccattcggcgatttcgggatggacgaaacggcacgcctttcgaccctggagaagatg
gccacgctggagccggtggatccgacctatccctcgatcaccgctgccgtgtccagctcc
acttgcgatgccgcagcggccgtgctggtggtgtcggaggctgcgcttaaacgctaccac
ctcacgcctcgcgcccgcattcaccatatgagcgtgcgcgccgatgatcccatctggcat
ctgacggcaccgattcccgccaccgaacatgcgctcaagaaggcgggcatgacgatgtcc
gacatcgacctggtcgagatcaacgaggctttcgcttccgtggtcatggcctggctcaag
gaaaccggctacgacccagccaggaccaatgtcaacggcggcgcgattgcgctgggccat
ccgctgggggcctcgggcgccaagctcatgaccacgctgctgcacgagctggagcgcacc
ggcggccgcttcggtctgcagaccatgtgcgaaggcggaggtcaggccaacgtcaccatc
atcgaacgtctctga

DBGET integrated database retrieval system